CN181478

Overview
NameCN181478
Unique NameCN181478
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length705
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2266 contig Csv1_Contig2266:1..705. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181478 vs. ExPASy Swiss-Prot
Match: PDI_RICCO (Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 1.329e-88
Identity = 157/200 (78.50%), Postives = 178/200 (89.00%), Query Frame = 2
Query:    5 ISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKDEL 604
            I  LLGD+EASQGAFQYFGL+E QVPLI+IQTNDGQKYLK NL+ D IAPWVK YKEGKV  +RKSEPIPE NNEPVKV+VAD+LQD+VFNSGKNVLLEFYAPWCGHCK+LAPILDEVAVSY++DAD+VIAK DATANDIP DTF+V+GYPTV+FRSASGK   Y+GDRTK+DI+ FIE NRDKAA +E+    +GKDEL
Sbjct:  302 IILLLGDVEASQGAFQYFGLKEDQVPLIIIQTNDGQKYLKANLEPDHIAPWVKAYKEGKVQAYRKSEPIPEVNNEPVKVVVADTLQDIVFNSGKNVLLEFYAPWCGHCKQLAPILDEVAVSYKSDADIVIAKLDATANDIPSDTFDVRGYPTVYFRSASGKVEQYDGDRTKDDIISFIEKNRDKAAQQESA---NGKDEL 498          

HSP 2 Score: 68.9366 bits (167), Expect = 2.927e-11
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  215 EENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTVFFRSASGKTV-PYEGDRTKEDIVDFIENNRDKAA 562
            EE    V  L + +  D + +    +++EFYAPWCGHCKKL P  ++ A +   +D  VV+AK DA   AN      ++++G+PT+      GK++  Y+G R  + I ++++     A+
Sbjct:   28 EEEQSSVLTLDSTNFTDTI-SKHDFIVVEFYAPWCGHCKKLRPEYEKAASILKSHDIPVVLAKVDANEEANKELATQYDIKGFPTLKILRNGGKSIQEYKGPREADGIAEYLKKQSGPAS 146          
BLAST of CN181478 vs. ExPASy Swiss-Prot
Match: PDI_DATGL (Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 2.054e-81
Identity = 139/198 (70.20%), Postives = 172/198 (86.87%), Query Frame = 2
Query:    5 ISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKD 598
            ISFL+GD E+SQGAFQYFGL++ QVPLIVIQ NDG KYLKPNL+ D IA WVKEYK+ K+ P+RKSEPIPE NNEPVKV+VADSL ++VF SGKNVLLEFYAPWCGHCK+LAPILDEVAVS++ND DV+IAK DATAND P +TF+V+GYPT++F+SASG+ + Y+G RTKED ++FIE NR+K++ KE++ ++   D
Sbjct:  303 ISFLIGDTESSQGAFQYFGLRDDQVPLIVIQNNDGTKYLKPNLEPDHIASWVKEYKDCKLSPYRKSEPIPEHNNEPVKVVVADSLDEIVFKSGKNVLLEFYAPWCGHCKQLAPILDEVAVSFENDPDVLIAKLDATANDYPTNTFDVKGYPTLYFKSASGELLQYDGGRTKEDFIEFIEKNREKSSKKESIVKDDQTD 500          

HSP 2 Score: 75.8702 bits (185), Expect = 2.395e-13
Identity = 49/132 (37.12%), Postives = 70/132 (53.03%), Query Frame = 2
Query:  200 SEPIPEENNEPVKVLVADSLQDMVFNSGKN-VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTVFFRSASGKTV-PYEGDRTKEDIVDFIENNRDKAAPKETVK 580
            +E   EE+     VL  D        S  N +++EFYAPWCGHCKKLAP  ++ A +   +D  V++AK DA   AN      FEV+G+PT+      GK V  Y+G R  + IVD+++  +    P   +K
Sbjct:   22 NEIYAEESESKEFVLTLDKSNFFDTVSKHNFIVVEFYAPWCGHCKKLAPEYEKAASILSSHDPPVILAKVDANEEANKELASEFEVRGFPTIKILRNGGKIVQEYKGPRDADGIVDYLK--KQSGPPSAEIK 151          
BLAST of CN181478 vs. ExPASy Swiss-Prot
Match: PDI_MEDSA (Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.332e-80
Identity = 144/210 (68.57%), Postives = 173/210 (82.38%), Query Frame = 2
Query:    5 ISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA--------PKETVKEES--GKDEL 604
            +SFL+GD+E+SQGAFQYFGL+E QVPLI+IQ NDG+K+ KPNL+ DQ+  W+K YK+GKV PF KSEPIPE NNEPVKV+V  +L+D+VF SGKNVL+EFYAPWCGHCK+LAPILDEVAVS+Q+DADVVIAK DATANDIP DTF+VQGYPT++FRSASGK   Y+G RTKEDI++FIE N+DK          PK   + E+   KDEL
Sbjct:  303 VSFLVGDVESSQGAFQYFGLKEEQVPLIIIQHNDGKKFFKPNLELDQLPTWLKAYKDGKVEPFVKSEPIPETNNEPVKVVVGQTLEDVVFKSGKNVLIEFYAPWCGHCKQLAPILDEVAVSFQSDADVVIAKLDATANDIPTDTFDVQGYPTLYFRSASGKLSQYDGGRTKEDIIEFIEKNKDKTGAAHQEVEQPKAAAQPEAEQPKDEL 512          

HSP 2 Score: 68.1662 bits (165), Expect = 4.993e-11
Identity = 36/96 (37.50%), Postives = 58/96 (60.42%), Query Frame = 2
Query:  290 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDATA---NDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA 562
            +++EFYAPWCGHCKKLAP  ++ A +   ++  VV+AK DA      D+  +  +V+G+PT+  FR+       Y+G R  E IV++++     A+
Sbjct:   53 IVVEFYAPWCGHCKKLAPEYEKAASILSTHEPPVVLAKVDANEEHNKDLASEN-DVKGFPTIKIFRNGGKNIQEYKGPREAEGIVEYLKKQSGPAS 147          
BLAST of CN181478 vs. ExPASy Swiss-Prot
Match: PDI1_ARATH (Probable protein disulfide-isomerase 1 OS=Arabidopsis thaliana GN=At1g21750 PE=1 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 4.284e-79
Identity = 139/202 (68.81%), Postives = 167/202 (82.67%), Query Frame = 2
Query:    5 ISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA--PKETVKEESGKDEL 604
            +SFLLGD E SQGAFQYFGL+ESQVPLI+IQT D +KYLK N++ DQI  WVK++K+GK+ P +KS+PIP ENNEPVKV+V+DSL D+V NSGKNVLLEFYAPWCGHC+KLAPILDEVAVSYQ+D+ VVIAK DATAND P DTF+V+G+PT++F+SASG  V YEGDRTKED + F++ N+D      KE    E  KDEL
Sbjct:  300 LSFLLGDAENSQGAFQYFGLEESQVPLIIIQTADDKKYLKTNVEVDQIESWVKDFKDGKIAPHKKSQPIPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDTVGEPKKEEETTEEVKDEL 501          

HSP 2 Score: 70.4774 bits (171), Expect = 1.006e-11
Identity = 44/119 (36.97%), Postives = 63/119 (52.94%), Query Frame = 2
Query:  218 ENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSY-QNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA 562
            E  E V  L   +  D + N    +++EFYAPWCGHCK+LAP  ++ A +   N   VV+AK DA+   N      +EVQG+PT+  FR+       Y G R  E IV +++     A+
Sbjct:   27 ETKEFVLTLDHTNFTDTI-NKHDFIVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSGPAS 144          
BLAST of CN181478 vs. ExPASy Swiss-Prot
Match: PDI2_ARATH (Protein disulfide-isomerase 2 OS=Arabidopsis thaliana GN=At1g77510 PE=1 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 1.524e-76
Identity = 136/212 (64.15%), Postives = 171/212 (80.66%), Query Frame = 2
Query:    5 ISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDK------------AAPKETVKEESGKDEL 604
            ++FL+GD E+SQGAFQYFGL+ESQVPLI+IQT D +KYLK N++ DQI  W K++++GKV   +KS+PIP ENNEPVKV+VA+SL D+VF SGKNVL+EFYAPWCGHC+KLAPILDEVA+S+QND  V+IAK DATANDIP DTF+V+G+PT++FRSASG  V YEGDRTKED ++F+E N +K              PK+T +E + KDEL
Sbjct:  298 LAFLVGDAESSQGAFQYFGLEESQVPLIIIQTPDNKKYLKVNVEVDQIESWFKDFQDGKVAVHKKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSVIIAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNSEKKPTSHGEESTKSEEPKKT-EETAAKDEL 508          
BLAST of CN181478 vs. ExPASy Swiss-Prot
Match: PDI_MAIZE (Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.249e-70
Identity = 129/211 (61.14%), Postives = 162/211 (76.78%), Query Frame = 2
Query:    5 ISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAP-----------KETVKEESGKDEL 604
            I FL+GD+EASQGAFQYFGL+E Q PLI+IQ  D +K+LK +++ADQI  W+KEY +GK+ PFR SEPIPE NNEPVKV+VAD++ D VF SGKNVL+EFYAPWCGHCKKLAPILDE A + Q+D +VVIAK DATAND+P + F+VQGYPT++F + SGK   Y+  RT +DIVDFI+ +++ AAP           +E  + E  KDEL
Sbjct:  304 IKFLIGDIEASQGAFQYFGLKEDQTPLILIQDGDSKKFLKVHVEADQIVAWLKEYFDGKLTPFRNSEPIPEVNNEPVKVVVADNVHDFVFKSGKNVLIEFYAPWCGHCKKLAPILDEAATTLQSDEEVVIAKMDATANDVPSE-FDVQGYPTLYFVTPSGKVTSYDSGRTADDIVDFIKKSKETAAPHHHHHPGATGIREGSRAEPVKDEL 513          

HSP 2 Score: 75.8702 bits (185), Expect = 2.395e-13
Identity = 46/135 (34.07%), Postives = 70/135 (51.85%), Query Frame = 2
Query:  197 KSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSY-QNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEES 589
            + EP      E V  L  DS  + V      +++EFYAPWCGHCKKLAP  +  A +  ++D  +V+AK DA    N      +E+QG+PT+  FR        Y+G R  + IVD+++     A+ +    E++
Sbjct:   24 EEEPAAAAEGEAVLTLDVDSFDEAVAKH-PFMVVEFYAPWCGHCKKLAPEYENAAKALSKHDPPIVLAKVDANEEKNRPLATKYEIQGFPTIKIFRDRGKNIQEYKGPREADGIVDYLKKQVGPASKEIKSPEDA 157          
BLAST of CN181478 vs. ExPASy Swiss-Prot
Match: PDI_HORVU (Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2)

HSP 1 Score: 261.151 bits (666), Expect = 4.019e-69
Identity = 120/197 (60.91%), Postives = 157/197 (79.70%), Query Frame = 2
Query:    5 ISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGK 595
            + FL+GD+E+SQGAFQYFGL+  Q PLI+IQ  D +K+LK +++A QI  W+K+Y +GK+ PFRKSEPIPE NNEPVKV+VAD++ D+VF SGKNVL+EFYAPWCGHCKKLAPILDE A + Q++ DVVIAK DAT ND+PG+ F+VQGYPT++F + SGK V YEG RT ++IVD+I  N++ A       E++ +
Sbjct:  307 VKFLIGDIESSQGAFQYFGLKVDQAPLILIQDGDSKKFLKEHVEAGQIVAWLKDYFDGKLTPFRKSEPIPEANNEPVKVVVADNVHDVVFKSGKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKMDATENDVPGE-FDVQGYPTLYFVTPSGKKVSYEGGRTADEIVDYIRKNKETAGQAAAATEKAAE 502          

HSP 2 Score: 77.7962 bits (190), Expect = 6.302e-14
Identity = 48/132 (36.36%), Postives = 73/132 (55.30%), Query Frame = 2
Query:  227 EPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIEN-----NRDKAAPKETVKEESGK 595
            E V  L AD+  D +      +L+EFYAPWCGHCK LAP  ++ A +  ++D  +V+AK DA    N      +EVQG+PT+  FR+       Y+G R  E IV++++      +++  AP++    E GK
Sbjct:   38 EAVLTLHADNFDDAI-GQHPFILVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPAIVLAKVDANDEKNKPLAGKYEVQGFPTLKIFRNGGKSIQEYKGPREAEGIVEYLKKQVGPASKEIKAPEDATYLEDGK 168          
BLAST of CN181478 vs. ExPASy Swiss-Prot
Match: PDI_WHEAT (Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 5.249e-69
Identity = 121/198 (61.11%), Postives = 156/198 (78.79%), Query Frame = 2
Query:    5 ISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKD 598
            + FL+GD+EASQGAFQY GL+E Q PLI+IQ +D +K+LK  ++A QI  W+K+Y +GK+ PFRKSEPIPE NNEPVKV+VAD++ D+VF S KNVL+EFYAPWCGHCKKLAPILDE A + Q++ DVVIAK DATAND+PG+ F+VQGYPT++F + SGK V YEG RT ++IVD+I+ N++ A        E   +
Sbjct:  308 VKFLIGDIEASQGAFQYNGLKEDQAPLILIQDSDSKKFLKEQVEAGQIVAWLKDYFDGKLTPFRKSEPIPEANNEPVKVVVADNIHDVVFKSAKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKIDATANDVPGE-FDVQGYPTLYFVTPSGKKVSYEGGRTADEIVDYIKKNKETAGQAAAAATEKAAE 504          

HSP 2 Score: 78.5666 bits (192), Expect = 3.694e-14
Identity = 49/132 (37.12%), Postives = 73/132 (55.30%), Query Frame = 2
Query:  227 EPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIEN-----NRDKAAPKETVKEESGK 595
            E V  L AD+  D +      +L+EFYAPWCGHCK LAP  ++ A +  ++D  +V+AK DA    N      +EVQG+PT+  FRS       Y+G R  E IV++++      +++  AP++    E GK
Sbjct:   39 EAVLTLHADNFDDAIAKH-PFILVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPAIVLAKVDANDEKNKPLAGKYEVQGFPTLKIFRSGGKNIQEYKGPREAEGIVEYLKKQVGPASKEIKAPEDATYLEDGK 169          
BLAST of CN181478 vs. ExPASy Swiss-Prot
Match: PDIA3_MOUSE (Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 3.797e-35
Identity = 77/205 (37.56%), Postives = 122/205 (59.51%), Query Frame = 2
Query:    2 RISFLLGDLEASQGAFQYFGLQES--QVPLIVIQTNDGQKYLKP---NLDADQIAPWVKEYKEGKVPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVP--YEGDRTKEDIVDFIENNRDKAAPKETVKEESGK 595
            +++F +   +        FGL+ +  +VP++ I+T  G+K++     + D   +  +++EY +G +  + KSEPIPE N  PVKV+VA++  D+V    K+VL+EFYAPWCGHCK L P   E+      D ++VIAK DATAND+P   +EV+G+PT++F  A+ K  P  YEG R   D + +++    +A     ++EE  K
Sbjct:  296 KLNFAVASRKTFSHELSDFGLESTTGEVPVVAIRTAKGEKFVMQEEFSRDGKALEQFLQEYFDGNLKRYLKSEPIPESNEGPVKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVP-SPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQR---EATNPPIIQEEKPK 496          

HSP 2 Score: 70.4774 bits (171), Expect = 1.006e-11
Identity = 50/157 (31.85%), Postives = 74/157 (47.13%), Query Frame = 2
Query:  242 LVADSLQDMVFNSGKN--VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEE-----SGKDEL*EGMGASLLESRAHSRLARVWRMLYQNYQ 691
            L  ++ +  V ++G    +L+EF+APWCGHCK+LAP  +  A   +    V +AK D TAN    + + V GYPT+       +   Y+G RT + IV  ++     A+     +EE     S KD    G    L  S  HS   +    L  NY+
Sbjct:   30 LTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLK--GIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFRDLF-SDGHSEFLKAASNLRDNYR 183          
BLAST of CN181478 vs. ExPASy Swiss-Prot
Match: PDIA3_RAT (Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 6.476e-35
Identity = 77/205 (37.56%), Postives = 122/205 (59.51%), Query Frame = 2
Query:    2 RISFLLGDLEASQGAFQYFGLQES--QVPLIVIQTNDGQKYLKP---NLDADQIAPWVKEYKEGKVPPFRKSEPIPEENNEPVKVLVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVP--YEGDRTKEDIVDFIENNRDKAAPKETVKEESGK 595
            +++F +   +        FGL+ +  ++P++ I+T  G+K++     + D   +  +++EY +G +  + KSEPIPE N  PVKV+VA+S  D+V    K+VL+EFYAPWCGHCK L P   E+      D ++VIAK DATAND+P   +EV+G+PT++F  A+ K  P  YEG R   D + +++    +A     ++EE  K
Sbjct:  296 KLNFAVASRKTFSHELSDFGLESTTGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQEYFDGNLKRYLKSEPIPETNEGPVKVVVAESFDDIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVP-SPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQR---EATNPPIIQEEKPK 496          

HSP 2 Score: 69.3218 bits (168), Expect = 2.241e-11
Identity = 49/157 (31.21%), Postives = 74/157 (47.13%), Query Frame = 2
Query:  242 LVADSLQDMVFNSGKN--VLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEE-----SGKDEL*EGMGASLLESRAHSRLARVWRMLYQNYQ 691
            L  ++ +  V ++G    +L+EF+APWCGHCK+LAP  +  A   +    V +AK D TAN    + + V GYPT+       +   Y+G RT + IV  ++     A+     ++E     S KD    G    L  S  HS   +    L  NY+
Sbjct:   30 LTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLK--GIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEDEFKKFISDKDASVVGFFRDLF-SDGHSEFLKAASNLRDNYR 183          
The following BLAST results are available for this feature:
BLAST of CN181478 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 70
Match NameE-valueIdentityDescription
PDI_RICCO1.329e-8878.50Protein disulfide-isomerase OS=Ricinus communis PE... [more]
PDI_DATGL2.054e-8170.20Protein disulfide-isomerase OS=Datisca glomerata G... [more]
PDI_MEDSA1.332e-8068.57Protein disulfide-isomerase OS=Medicago sativa GN=... [more]
PDI1_ARATH4.284e-7968.81Probable protein disulfide-isomerase 1 OS=Arabidop... [more]
PDI2_ARATH1.524e-7664.15Protein disulfide-isomerase 2 OS=Arabidopsis thali... [more]
PDI_MAIZE1.249e-7061.14Protein disulfide-isomerase OS=Zea mays GN=PDI PE=... [more]
PDI_HORVU4.019e-6960.91Protein disulfide-isomerase OS=Hordeum vulgare GN=... [more]
PDI_WHEAT5.249e-6961.11Protein disulfide-isomerase OS=Triticum aestivum G... [more]
PDIA3_MOUSE3.797e-3537.56Protein disulfide-isomerase A3 OS=Mus musculus GN=... [more]
PDIA3_RAT6.476e-3537.56Protein disulfide-isomerase A3 OS=Rattus norvegicu... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A04_r Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181478 ID=CN181478|Name=CN181478|organism=Citrus sinensis|type=EST|length=705bp
GAGGATTAGTTTTCTTTTGGGAGACCTTGAGGCTAGTCAAGGTGCCTTCC
AGTACTTTGGGCTACAAGAGAGCCAAGTACCTCTCATCGTCATTCAGACT
AATGATGGGCAGAAGTATTTGAAGCCGAACTTGGATGCCGATCAGATTGC
ACCTTGGGTGAAGGAATACAAGGAAGGCAAGGTTCCCCCATTCAGAAAGT
CTGAGCCTATCCCTGAAGAGAACAACGAGCCTGTGAAAGTGCTTGTTGCT
GACAGCCTTCAGGACATGGTTTTCAACTCTGGAAAAAATGTTTTGCTCGA
GTTTTACGCTCCTTGGTGTGGACACTGCAAAAAGTTGGCTCCAATCTTGG
ATGAAGTTGCTGTCTCATATCAAAACGATGCTGATGTTGTTATTGCAAAA
TTTGATGCAACCGCAAATGATATTCCTGGTGACACTTTTGAAGTCCAAGG
TTACCCAACCGTGTTCTTCCGATCTGCTAGTGGAAAGACAGTGCCCTATG
AGGGGGATAGGACCAAAGAAGATATTGTTGACTTCATTGAAAATAACAGG
GACAAAGCTGCCCCCAAGGAAACTGTAAAAGAGGAATCTGGAAAAGATGA
GCTCTAAGAAGGAATGGGTGCGAGTTTATTAGAGAGCCGTGCACATAGTC
GGTTGGCGCGTGTTTGGCGGATGTTATACCAAAACTATCAGTGTCGACAA
AACAA
back to top