CN181476

Overview
NameCN181476
Unique NameCN181476
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length653
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3464 contig Csv1_Contig3464:356..1008. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181476 vs. ExPASy Swiss-Prot
Match: PWD_ARATH (Phosphoglucan, water dikinase, chloroplastic OS=Arabidopsis thaliana GN=GWD3 PE=1 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 4.853e-95
Identity = 173/213 (81.22%), Postives = 194/213 (91.08%), Query Frame = 2
Query:    2 LIVRSSANVEDLAGMSAAGLYESIPNVNPSNLRVFQNAVARVWASLYTRRAVLSRQAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGETLASGTRGTPWRLSSGKFDGLVRTQAFANFSEEMLVSGAGPADGVVIHLTVDYSKKPLTVDPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKDIYVVQTRPQP 640
            LIVRSSANVEDLAGMSAAGLYESIPNV+PS+  VF ++V +VWASLYTRRAVLSR+AAGVSQ++A+MAVLVQEMLSPDLSFVLHT+SP D D N VEAEIAPGLGETLASGTRGTPWRL+SGK DG+V+T AFANFSEE+LVSG GPADG  + LTVDYSKK LTVD +FR+QLGQRL SVGFFLER FGC QDVEGCLVG+D+Y+VQ+RPQP
Sbjct:  983 LIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSVCQVWASLYTRRAVLSRRAAGVSQREASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGETLASGTRGTPWRLASGKLDGIVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTVDSVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQP 1195          
BLAST of CN181476 vs. ExPASy Swiss-Prot
Match: PWD_ORYSJ (Phosphoglucan, water dikinase, chloroplastic OS=Oryza sativa subsp. japonica GN=GWD3 PE=3 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 9.173e-86
Identity = 158/213 (74.18%), Postives = 182/213 (85.45%), Query Frame = 2
Query:    2 LIVRSSANVEDLAGMSAAGLYESIPNVNPSNLRVFQNAVARVWASLYTRRAVLSRQAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGETLASGTRGTPWRLSSGKFDGLVRTQAFANFSEEMLVSGAGPADGVVIHLTVDYSKKPLTVDPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKDIYVVQTRPQP 640
            LIVRSSANVEDLAGMSAAGLY+SIPNV+  +   F  AV +VWASLYTRRA+LSR+AAGV Q+DATMAVLVQE+L PDLSFVLHT+ P DHD   V+AE+APGLGETLASGTRGTPWRLS  KFDG V T AF+NFSEEM+V  +GPA+G VI LTVDYSKKPL+VD  FR+Q GQRL ++G +LE+KFG  QDVEGCLVGKDI++VQ+RPQP
Sbjct:  994 LIVRSSANVEDLAGMSAAGLYDSIPNVSLMDPCAFGAAVGKVWASLYTRRAILSRRAAGVYQRDATMAVLVQEILQPDLSFVLHTVCPADHDPKVVQAEVAPGLGETLASGTRGTPWRLSCNKFDGKVATLAFSNFSEEMVVHNSGPANGEVIRLTVDYSKKPLSVDTTFRKQFGQRLAAIGQYLEQKFGSAQDVEGCLVGKDIFIVQSRPQP 1206          
BLAST of CN181476 vs. ExPASy Swiss-Prot
Match: GWD2_ARATH (Alpha-glucan water dikinase 2 OS=Arabidopsis thaliana GN=GWD2 PE=2 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 3.212e-22
Identity = 65/198 (32.83%), Postives = 100/198 (50.51%), Query Frame = 2
Query:  113 AVARVWASLYTRRAVLSRQAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGETLASGTRGTPWRLSSGKFDGLVRT------QAFANFSEEMLV-------------SGAGPADGVVI----HLTVDYSKKPLTVDPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKDIYVVQTRPQ 637
            A+ +VWAS +  RA +S +   +      MAVL+QE++  D +FV+HT +P   D + +  EI  GLGETL     G      + K +    T      +    +S+  ++             +GAG  D V++     + VDYS++PL +D  FR +L   +   G  +E  +GCPQD+EG + G  IY+VQ RPQ
Sbjct: 1080 AIKKVWASKWNERAYVSCKKNKLDHDAVCMAVLIQEVICGDYAFVIHTNNPVSGDSSEIYTEIVKGLGETLVGAYPGRAMSFITKKTNLKSPTVISYPSKRIGLYSKPSIIFRSDSNNEDLEGNAGAGLYDSVIMDEAEEVVVDYSREPLIMDKSFRVRLFSAIAEAGNVIESIYGCPQDIEGVVKGGHIYIVQARPQ 1277          
BLAST of CN181476 vs. ExPASy Swiss-Prot
Match: PPS_BACSU (Putative phosphoenolpyruvate synthase OS=Bacillus subtilis GN=pps PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.182e-16
Identity = 66/213 (30.99%), Postives = 101/213 (47.42%), Query Frame = 2
Query:    8 VRSSANVEDLAGMSAAGLYESIPNVNPSNLRVFQNAVARVWASLYTRRAVLSRQAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGETLASGTRGTPWRLSSGKF---DGLVRTQAFANFSEEMLVSGAGPADGVVIHLTVDYSK-KPLTVDPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKDIYVVQTRP 634
            VRSSA  EDL   S AG  ++  N+  + +      +++ WASL+T RAV+ R   G       ++V+VQ M+ P  S +L T  P   +   +  +   GLGE L SG       +S+  F   DG +  +  A  +++M + G          +  D  K + LT + I       +L  +G  +E  FG PQD+E CL     Y+VQ+RP
Sbjct:  115 VRSSATAEDLPHASFAGQQDTYLNI--TGVDAILQHISKCWASLFTDRAVIYRMQNGFDHSQVYLSVIVQRMVFPQASGILFTADPITSNRKVLSIDAGFGLGEALVSGL------VSADCFKVQDGQIIDKRIA--TKKMAIYGRKEGGTETQQIDSDQQKAQTLTDEQIL------QLARIGRQIEAHFGQPQDIEWCLARDTFYIVQSRP 311          
BLAST of CN181476 vs. ExPASy Swiss-Prot
Match: PPSA_ARCFU (Probable phosphoenolpyruvate synthase OS=Archaeoglobus fulgidus GN=ppsA PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.967e-15
Identity = 65/209 (31.10%), Postives = 101/209 (48.33%), Query Frame = 2
Query:    8 VRSSANVEDLAGMSAAGLYESIPNVNPSNLRVFQNAVARVWASLYTRRAVLSRQAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGETLASGTRGTPWRLSSGKFDGLVRTQAFANFSEEMLVSGAGPADGVVIHLTVDYSKKPLTVDPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKDIYVVQTRP 634
            VRSSA  EDL   S AG  E+  NV   +  V    V + W SL+T RA+  R   G   +D ++AV+VQ+M++ + S V+ T  P   +   +  E   GLGE + SG   TP    +  +D + R        E+  +        V + L  + + + +  D        ++L ++G  +E  +G PQDVE  + G  IY+VQ+RP
Sbjct:  116 VRSSATAEDLPDASFAGQQETYLNVVGEDEVV--EKVKKCWGSLFTPRAIYYRVQKGFRHEDVSIAVVVQKMVNSEKSGVMFTSHPVSGEKKCI-IEAVFGLGEAIVSGL-VTP---DTYVYDRVKRKIEEVKIGEKKFMLTRKDGKTVKVELPPEKANERVLSDEEI-----EKLVTLGELIEDHYGKPQDVEWAIEGGKIYIVQSRP 312          
BLAST of CN181476 vs. ExPASy Swiss-Prot
Match: PPSA_PYRAB (Probable phosphoenolpyruvate synthase OS=Pyrococcus abyssi GN=ppsA PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.223e-13
Identity = 60/211 (28.44%), Postives = 97/211 (45.97%), Query Frame = 2
Query:    8 VRSSANVEDLAGMSAAGLYESIPNVNPSNLRVFQNAVARVWASLYTRRAVLSRQAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGETLASGTRGTPWRLSSGKFDGLVRTQAFANFSEEMLVSGAGPADGVVIHLTVDYSKKPLTVDPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKD--IYVVQTRP 634
            VRSSA  EDL   S AG  E+  +V  ++  +  + V R WASL+T RA   R   G       ++ +VQ+M++ + S V+ T +P  ++ N +    + GLGE + SG   TP      K    ++ +  A   E M++       G V     +Y         +   +    +  +G  +E  +G PQD+E      D  +Y+VQ+RP
Sbjct:  152 VRSSATAEDLPEASFAGQQETYLDVLGADDVI--DKVKRCWASLWTARATFYRAKQGFDHSKVYLSAVVQKMVNSEKSGVMFTANPVTNNRNEIMINASWGLGEAVVSGA-VTPDEYIVEKGTWKIKEKVIAK-KEVMVIRNPETGKGTVTVKVAEYLGPEWVEKQVLTDEQIIEVAKMGQKIEEHYGWPQDIEWAYDKDDGKLYIVQSRP 358          
BLAST of CN181476 vs. ExPASy Swiss-Prot
Match: PPSA_PYRFU (Phosphoenolpyruvate synthase OS=Pyrococcus furiosus GN=ppsA PE=1 SV=3)

HSP 1 Score: 76.2554 bits (186), Expect = 1.598e-13
Identity = 60/211 (28.44%), Postives = 98/211 (46.45%), Query Frame = 2
Query:    8 VRSSANVEDLAGMSAAGLYESIPNVNPSNLRVFQNAVARVWASLYTRRAVLSRQAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGETLASGTRGTPWRLSSGKFDGLVRTQAFANFSEEMLVSGAGPADGVVIHLTVDYSKKPLTVDPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKD--IYVVQTRP 634
            VRSSA  EDL   S AG  E+  +V  ++  +  + V R WASL+T RA   R   G       ++ +VQ+M++ + S V+ T +P  ++ N +    + GLGE + SG   TP      K    ++ +  A   E M++       G V+    +Y         +   +    +  +G  +E  +G PQD+E      D  +Y+VQ+RP
Sbjct:  152 VRSSATAEDLPEASFAGQQETYLDVLGADDVI--DKVKRCWASLWTARATFYRAKQGFDHSKVYLSAVVQKMVNSEKSGVMFTANPVTNNRNEIMINASWGLGEAVVSGA-VTPDEYIVEKGTWKIKEKVIAK-KEVMVIRNPETGRGTVMVKVAEYLGPEWVEKQVLTDEQIIEVAKMGQKIEDHYGWPQDIEWAYDKDDGKLYIVQSRP 358          
BLAST of CN181476 vs. ExPASy Swiss-Prot
Match: PPSA_PYRHO (Probable phosphoenolpyruvate synthase OS=Pyrococcus horikoshii GN=ppsA PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.649e-13
Identity = 59/211 (27.96%), Postives = 97/211 (45.97%), Query Frame = 2
Query:    8 VRSSANVEDLAGMSAAGLYESIPNVNPSNLRVFQNAVARVWASLYTRRAVLSRQAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGETLASGTRGTPWRLSSGKFDGLVRTQAFANFSEEMLVSGAGPADGVVIHLTVDYSKKPLTVDPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKD--IYVVQTRP 634
            VRSSA  EDL   S AG  E+  +V  ++  +  + V + WASL+T RA   R   G       ++ +VQ+M++ + S V+ T +P  ++ N +    + GLGE + SG   TP      K    ++ +  A   E M++       G V     +Y         +   +    +  +G  +E  +G PQD+E      D  +Y+VQ+RP
Sbjct:  155 VRSSATAEDLPEASFAGQQETYLDVLGADDVI--DKVKKCWASLWTARATFYRAKQGFDHSKVYLSAVVQKMVNSEKSGVMFTANPVTNNRNEIMINASWGLGEAVVSGA-VTPDEYIVEKGTWKIKEKVIAK-KEVMVIRNPETGKGTVQVKVAEYLGPEWVEKQVLTDEQIIEVAKMGQKIEEHYGWPQDIEWAYDKDDGKLYIVQSRP 361          
BLAST of CN181476 vs. ExPASy Swiss-Prot
Match: PPSA_STAMF (Probable phosphoenolpyruvate synthase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) GN=ppsA PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 8.767e-12
Identity = 66/234 (28.21%), Postives = 106/234 (45.30%), Query Frame = 2
Query:    8 VRSSANVEDLAGMSAAGLYESIPNVNPSNLRVFQNAVARVWASLYTRRAVLSRQAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGETLASGTRGTP--WRLSSGKF---DGLVRTQAFA---------------NFSEEMLVSGAGPAD-GVVIHLTVDYSKKPLTVDPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCL-----VGKDIYVVQTR 631
            VRSSA  ED+   S AG  ++  NV   +  V+   V R WASL+T RAV  R A G+  + + M+V VQ+M++   + V+ TL P   D   V  E + GLGE++  G + TP  W +        D  +  +  A               + +++  VS  GP D  +V H   D         P  + +  +RL  +   +E+ +G   D+E  +        ++++VQ R
Sbjct:  127 VRSSATAEDMPEASFAGQQDTYLNVYGEDNVVYY--VKRCWASLFTSRAVFYRVAQGIPHEKSLMSVTVQKMVNSRTAGVMFTLHPVTGDEKVVVIEASWGLGESVVGG-KVTPDEWVVDKQTLQIVDQKIHHKTLAIVFDPKKGKNVEIRWDENKQAWVSEEGPVDIEMVKHFHPD--------KPALKEEEVKRLAELALLIEKHYGRHMDIEWAVDYDIPFPDNVFIVQAR 349          
BLAST of CN181476 vs. ExPASy Swiss-Prot
Match: PPSA_METJA (Probable phosphoenolpyruvate synthase OS=Methanocaldococcus jannaschii GN=ppsA PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 8.767e-12
Identity = 56/209 (26.79%), Postives = 98/209 (46.89%), Query Frame = 2
Query:    8 VRSSANVEDLAGMSAAGLYESIPNVNPSNLRVFQNAVARVWASLYTRRAVLSRQAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGETLASGTRGTPWRLSSGKFDGLVRTQAFANFSEEMLVSGAGPADGVVIHLTVDYSKKPLTVDPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKDIYVVQTRP 634
            VRSSA  EDL   S AG  ++  N+  +   V    V + ++SL+T RA+  R+  G       +A +VQ++++ + + V+ T++P   +++ +  E A GLGE + SG+      + + K   +V         E M V      +  V+ +  D  +K +  D   +      L  +G  +E+ +G P DVE        Y++Q RP
Sbjct:  129 VRSSATAEDLPEASFAGQQDTYLNIKGAENVV--KYVQKCFSSLFTPRAIFYREQQGFDHFKVALAAVVQKLVNAEKAGVMFTVNPISENYDELVIEAAWGLGEGVVSGSVSPDTYIVNKKTLEIVDKHIAR--KETMFVKDE-KGETKVVEVPDDMKEKQVLSDDEIK-----ELAKIGLNIEKHYGKPMDVEWAYEKGKFYMLQARP 327          
The following BLAST results are available for this feature:
BLAST of CN181476 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
PWD_ARATH4.853e-9581.22Phosphoglucan, water dikinase, chloroplastic OS=Ar... [more]
PWD_ORYSJ9.173e-8674.18Phosphoglucan, water dikinase, chloroplastic OS=Or... [more]
GWD2_ARATH3.212e-2232.83Alpha-glucan water dikinase 2 OS=Arabidopsis thali... [more]
PPS_BACSU1.182e-1630.99Putative phosphoenolpyruvate synthase OS=Bacillus ... [more]
PPSA_ARCFU4.967e-1531.10Probable phosphoenolpyruvate synthase OS=Archaeogl... [more]
PPSA_PYRAB1.223e-1328.44Probable phosphoenolpyruvate synthase OS=Pyrococcu... [more]
PPSA_PYRFU1.598e-1328.44Phosphoenolpyruvate synthase OS=Pyrococcus furiosu... [more]
PPSA_PYRHO4.649e-1327.96Probable phosphoenolpyruvate synthase OS=Pyrococcu... [more]
PPSA_STAMF8.767e-1228.21Probable phosphoenolpyruvate synthase OS=Staphylot... [more]
PPSA_METJA8.767e-1226.79Probable phosphoenolpyruvate synthase OS=Methanoca... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A03_r Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181476 ID=CN181476|Name=CN181476|organism=Citrus sinensis|type=EST|length=653bp
TTTGATTGTCCGTTCAAGTGCCAATGTTGAGGACTTGGCTGGAATGTCAG
CTGCAGGACTTTATGAATCAATCCCTAATGTTAACCCTTCGAATCTAAGA
GTTTTTCAAAATGCTGTTGCTCGAGTGTGGGCTTCGCTTTACACTCGCAG
AGCAGTTTTAAGCCGTCAAGCTGCTGGTGTGTCTCAGAAAGATGCTACAA
TGGCAGTTCTTGTGCAAGAAATGCTTTCCCCAGATCTCTCATTTGTGCTT
CATACCCTCAGCCCAACAGATCATGACCATAACTCTGTAGAGGCTGAAAT
TGCCCCTGGACTTGGTGAAACTCTAGCTTCTGGTACCAGAGGCACACCGT
GGCGTCTGTCTTCTGGGAAGTTTGATGGGCTGGTGAGGACACAGGCGTTT
GCCAATTTCAGTGAAGAGATGCTCGTATCTGGTGCAGGTCCTGCTGATGG
GGTAGTGATTCACTTGACTGTAGATTATAGCAAGAAACCCTTAACAGTTG
ATCCAATTTTCCGTCGTCAGCTCGGTCAGCGCCTCTGTTCTGTTGGTTTC
TTTCTTGAGAGGAAGTTTGGCTGCCCACAGGACGTAGAAGGATGCCTGGT
TGGCAAGGATATCTATGTAGTCCAAACGCGTCCACAACCCCACTAAAATA
TTC
back to top