CN181475

Overview
NameCN181475
Unique NameCN181475
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length506
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN181475 vs. ExPASy Swiss-Prot
Match: PWD_ARATH (Phosphoglucan, water dikinase, chloroplastic OS=Arabidopsis thaliana GN=GWD3 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 4.008e-33
Identity = 66/85 (77.65%), Postives = 75/85 (88.24%), Query Frame = -1
Query:  252 RTQAFANFSEEMLVSGAGPADGVVIHLTVDYSKKPLTVDPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKDIYVVQTRPQP 506
            +T AFANFSEE+LVSG GPADG  + LTVDYSKK LTVD +FR+QLGQRL SVGFFLER FGC QDVEGCLVG+D+Y+VQ+RPQP
Sbjct: 1111 QTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTVDSVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQP 1195          
BLAST of CN181475 vs. ExPASy Swiss-Prot
Match: PWD_ORYSJ (Phosphoglucan, water dikinase, chloroplastic OS=Oryza sativa subsp. japonica GN=GWD3 PE=3 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 5.988e-29
Identity = 59/84 (70.24%), Postives = 72/84 (85.71%), Query Frame = -1
Query:  252 TQAFANFSEEMLVSGAGPADGVVIHLTVDYSKKPLTVDPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKDIYVVQTRPQP 503
            T AF+NFSEEM+V  +GPA+G VI LTVDYSKKPL+VD  FR+Q GQRL ++G +LE+KFG  QDVEGCLVGKDI++VQ+RPQP
Sbjct: 1123 TLAFSNFSEEMVVHNSGPANGEVIRLTVDYSKKPLSVDTTFRKQFGQRLAAIGQYLEQKFGSAQDVEGCLVGKDIFIVQSRPQP 1206          
The following BLAST results are available for this feature:
BLAST of CN181475 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PWD_ARATH4.008e-3377.65Phosphoglucan, water dikinase, chloroplastic OS=Ar... [more]
PWD_ORYSJ5.988e-2970.24Phosphoglucan, water dikinase, chloroplastic OS=Or... [more]
back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A03_f Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181475 ID=CN181475|Name=CN181475|organism=Citrus sinensis|type=EST|length=506bp
TTTTTTTTTTTAGATTTCTTCAGATTTCTTGCTCTTCATCAAAAAGCCTC
ATCAAAGTGAATAATACATAAATTGCATGCCGTACTTTTCTGCAACAGCA
CAAAGGGTGCACAAGCCAGGATGTCTTTTTACTAATTAATATCTGACAAT
CAAACAACTAACAAGATCACTGACTCTTGGTTTGAGCGAAGCTGCTGCCC
CTAGTAAAAAAACTAGAACAGAACAGTCTCGGAAGCGTGAATATTTTAGT
GGGGTTGTGGACGCGTTTGGACTACATAGATATCCTTGCCAACCAGGCAT
CCTTCTACGTCCTGTGGGCAGCCAAACTTCCTCTCAAGAAAGAAACCAAC
AGAACAGAGGCGCTGACCGAGCTGACGACGGAAAATTGGATCAACTGTTA
AGGGTTTCTTGCTATAATCTACAGTCAAGTGAATCACTACCCCATCAGCA
GGACCTGCACCAGATACGAGCATCTCTTCACTGAAATTGGCAAACGCCTG
TGTCCT
back to top