CN181474

Overview
NameCN181474
Unique NameCN181474
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length634
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5915 contig Csv1_Contig5915:7..640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181474 vs. ExPASy Swiss-Prot
Match: RH56_ARATH (DEAD-box ATP-dependent RNA helicase 56 OS=Arabidopsis thaliana GN=RH56 PE=2 SV=2)

HSP 1 Score: 273.863 bits (699), Expect = 4.923e-73
Identity = 136/170 (80.00%), Postives = 142/170 (83.53%), Query Frame = 1
Query:  124 MGETRDNXXXXXXXXXXXXXAQAPDSVATKANGEAAKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPPIV 633
            MG+ RDN              +       K NGEA KKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ EP+PGQV+ALVLCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNIKIHKDLLKNECP IV
Sbjct:    1 MGDARDNEAYEEELLDYEEEDEKVPDSGNKVNGEAVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIV 170          
BLAST of CN181474 vs. ExPASy Swiss-Prot
Match: RH15_ARATH (DEAD-box ATP-dependent RNA helicase 15 OS=Arabidopsis thaliana GN=RH15 PE=2 SV=2)

HSP 1 Score: 273.863 bits (699), Expect = 4.923e-73
Identity = 136/170 (80.00%), Postives = 142/170 (83.53%), Query Frame = 1
Query:  124 MGETRDNXXXXXXXXXXXXXAQAPDSVATKANGEAAKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPPIV 633
            MG+ RDN              +       K NGEA KKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ EP+PGQV+ALVLCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNIKIHKDLLKNECP IV
Sbjct:    1 MGDARDNEAYEEELLDYEEEDEKVPDSGNKVNGEAVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIV 170          
BLAST of CN181474 vs. ExPASy Swiss-Prot
Match: RH15_ORYSJ (DEAD-box ATP-dependent RNA helicase 15 OS=Oryza sativa subsp. japonica GN=Os01g0550000 PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 7.612e-66
Identity = 121/145 (83.45%), Postives = 130/145 (89.66%), Query Frame = 1
Query:  199 SVATKANGEAAKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPPIV 633
            + A  A+ +  KKGYVGIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQ +P  GQV ALVLCHTRELAYQICHEFERFS YLP++KVAVFYGGV+IK HKDLLKN+CP IV
Sbjct:   31 AAAANASADVVKKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIKKHKDLLKNDCPHIV 175          
BLAST of CN181474 vs. ExPASy Swiss-Prot
Match: RH56_ORYSJ (DEAD-box ATP-dependent RNA helicase 56 OS=Oryza sativa subsp. japonica GN=Os01g0549700 PE=2 SV=2)

HSP 1 Score: 249.595 bits (636), Expect = 9.942e-66
Identity = 121/143 (84.62%), Postives = 129/143 (90.21%), Query Frame = 1
Query:  205 ATKANGEAAKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPPIV 633
            A  A+ +  KKGYVGIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQ +P  GQV ALVLCHTRELAYQICHEFERFS YLP++KVAVFYGGV+IK HKDLLKN+CP IV
Sbjct:   33 AANASADVVKKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIKKHKDLLKNDCPHIV 175          
BLAST of CN181474 vs. ExPASy Swiss-Prot
Match: UAP56_PONAB (Spliceosome RNA helicase BAT1 OS=Pongo abelii GN=BAT1 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.439e-56
Identity = 109/154 (70.78%), Postives = 125/154 (81.17%), Query Frame = 1
Query:  196 DSVATKANGEAA--------KKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPPIV 633
            D V T A G+ A        K  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVL+TLQQ EP  GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG++IK  +++LK  CP IV
Sbjct:   16 DEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIV 169          
BLAST of CN181474 vs. ExPASy Swiss-Prot
Match: UAP56_PIG (Spliceosome RNA helicase BAT1 OS=Sus scrofa GN=BAT1 PE=3 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 1.439e-56
Identity = 109/154 (70.78%), Postives = 125/154 (81.17%), Query Frame = 1
Query:  196 DSVATKANGEAA--------KKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPPIV 633
            D V T A G+ A        K  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVL+TLQQ EP  GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG++IK  +++LK  CP IV
Sbjct:   16 DEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIV 169          
BLAST of CN181474 vs. ExPASy Swiss-Prot
Match: UAP56_PANTR (Spliceosome RNA helicase BAT1 OS=Pan troglodytes GN=BAT1 PE=3 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.439e-56
Identity = 109/154 (70.78%), Postives = 125/154 (81.17%), Query Frame = 1
Query:  196 DSVATKANGEAA--------KKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPPIV 633
            D V T A G+ A        K  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVL+TLQQ EP  GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG++IK  +++LK  CP IV
Sbjct:   16 DEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIV 169          
BLAST of CN181474 vs. ExPASy Swiss-Prot
Match: UAP56_MACMU (Spliceosome RNA helicase BAT1 OS=Macaca mulatta GN=BAT1 PE=3 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.439e-56
Identity = 109/154 (70.78%), Postives = 125/154 (81.17%), Query Frame = 1
Query:  196 DSVATKANGEAA--------KKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPPIV 633
            D V T A G+ A        K  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVL+TLQQ EP  GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG++IK  +++LK  CP IV
Sbjct:   16 DEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIV 169          
BLAST of CN181474 vs. ExPASy Swiss-Prot
Match: UAP56_HUMAN (Spliceosome RNA helicase BAT1 OS=Homo sapiens GN=BAT1 PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.439e-56
Identity = 109/154 (70.78%), Postives = 125/154 (81.17%), Query Frame = 1
Query:  196 DSVATKANGEAA--------KKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPPIV 633
            D V T A G+ A        K  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVL+TLQQ EP  GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG++IK  +++LK  CP IV
Sbjct:   16 DEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIV 169          
BLAST of CN181474 vs. ExPASy Swiss-Prot
Match: UAP56_BOVIN (Spliceosome RNA helicase BAT1 OS=Bos taurus GN=BAT1 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.879e-56
Identity = 109/154 (70.78%), Postives = 124/154 (80.52%), Query Frame = 1
Query:  196 DSVATKANGEAA--------KKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPPIV 633
            D V T A G+ A        K  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVL+TLQQ EP  GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KVAVF+GG++IK  +++LK  CP IV
Sbjct:   16 DEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPSVKVAVFFGGLSIKKDEEVLKKNCPHIV 169          
The following BLAST results are available for this feature:
BLAST of CN181474 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 318
Match NameE-valueIdentityDescription
RH56_ARATH4.923e-7380.00DEAD-box ATP-dependent RNA helicase 56 OS=Arabidop... [more]
RH15_ARATH4.923e-7380.00DEAD-box ATP-dependent RNA helicase 15 OS=Arabidop... [more]
RH15_ORYSJ7.612e-6683.45DEAD-box ATP-dependent RNA helicase 15 OS=Oryza sa... [more]
RH56_ORYSJ9.942e-6684.62DEAD-box ATP-dependent RNA helicase 56 OS=Oryza sa... [more]
UAP56_PONAB1.439e-5670.78Spliceosome RNA helicase BAT1 OS=Pongo abelii GN=B... [more]
UAP56_PIG1.439e-5670.78Spliceosome RNA helicase BAT1 OS=Sus scrofa GN=BAT... [more]
UAP56_PANTR1.439e-5670.78Spliceosome RNA helicase BAT1 OS=Pan troglodytes G... [more]
UAP56_MACMU1.439e-5670.78Spliceosome RNA helicase BAT1 OS=Macaca mulatta GN... [more]
UAP56_HUMAN1.439e-5670.78Spliceosome RNA helicase BAT1 OS=Homo sapiens GN=B... [more]
UAP56_BOVIN1.879e-5670.78Spliceosome RNA helicase BAT1 OS=Bos taurus GN=BAT... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A02_r Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181474 ID=CN181474|Name=CN181474|organism=Citrus sinensis|type=EST|length=634bp
GAGGATTCTACTCCCTTTCAAATCTTTTTCTCCTTTTATTTTGGCTAATT
ATTTTCATTTGCAGCACTCTCTCGCCAAACCCTAACCCTAAAACCCCAAC
CGTTTATTCAAATACTGGCAGGAATGGGAGAGACAAGAGACAACGAGTAC
GAGGATGAGCTTCTCGACTACGAGGAAGAAGATGCTCAAGCTCCCGATTC
CGTCGCTACCAAAGCAAACGGCGAAGCCGCCAAGAAGGGCTATGTTGGTA
TACACAGTTCAGGATTCAGAGACTTTCTTTTGAAGCCGGAACTTCTTCGT
GCAATTGTGGACTCAGGATTTGAGCATCCTTCAGAAGTGCAACATGAATG
CATACCTCAAGCGATTCTGGGCATGGATGTTATTTGCCAAGCTAAATCAG
GGATGGGGAAGACTGCTGTGTTTGTTCTGTCAACTCTTCAGCAAACAGAG
CCAAATCCAGGCCAAGTTACTGCACTTGTTTTATGTCACACTAGAGAGTT
AGCTTATCAGATCTGCCATGAGTTTGAGAGGTTCAGTACTTACCTGCCTG
ATATCAAGGTTGCTGTCTTTTATGGTGGAGTTAATATAAAAATTCACAAA
GATTTGCTGAAAAACGAATGTCCCCCAATTGTTG
back to top