CN181473

Overview
NameCN181473
Unique NameCN181473
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length639
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2887 contig Csv1_Contig2887:84..722. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181473 vs. ExPASy Swiss-Prot
Match: MBF1B_ARATH (Multiprotein-bridging factor 1b OS=Arabidopsis thaliana GN=MBF1B PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.031e-54
Identity = 110/139 (79.14%), Postives = 120/139 (86.33%), Query Frame = -3
Query:  182 MAGIGPITQDWEPVVIXXXXXXXXXXXXXKVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTKLERALGVKLR 598
            MAGIGPITQDWEPVVI             K VNAARR+GADIETVRK +AG+NKAASS TSLNT+KLD+DTENL+HDRVP+ELKKAI+QAR +KKLTQSQLA LINEKPQVIQEYESGKAIPNQQIL+KLERALG KLR
Sbjct:    1 MAGIGPITQDWEPVVIRKRAPNAAAKRDEKTVNAARRSGADIETVRKFNAGSNKAASSGTSLNTKKLDDDTENLSHDRVPTELKKAIMQARGEKKLTQSQLAHLINEKPQVIQEYESGKAIPNQQILSKLERALGAKLR 139          
BLAST of CN181473 vs. ExPASy Swiss-Prot
Match: MBF1A_ARATH (Multiprotein-bridging factor 1a OS=Arabidopsis thaliana GN=MBF1A PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.031e-54
Identity = 110/139 (79.14%), Postives = 119/139 (85.61%), Query Frame = -3
Query:  182 MAGIGPITQDWEPVVIXXXXXXXXXXXXXKVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTKLERALGVKLR 598
            MAGIGPITQDWEPVVI             K VNAARR+GADIETVRK +AGTNKAASS TSLNT+ LD+DTENL H+RVP+ELKKAI+QAR DKKLTQSQLAQ+INEKPQVIQEYESGKAIPNQQIL+KLERALG KLR
Sbjct:    1 MAGIGPITQDWEPVVIRKKPANAAAKRDEKTVNAARRSGADIETVRKFNAGTNKAASSGTSLNTKMLDDDTENLTHERVPTELKKAIMQARTDKKLTQSQLAQIINEKPQVIQEYESGKAIPNQQILSKLERALGAKLR 139          
BLAST of CN181473 vs. ExPASy Swiss-Prot
Match: MBF1C_ARATH (Multiprotein-bridging factor 1c OS=Arabidopsis thaliana GN=MBF1C PE=1 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 3.986e-30
Identity = 68/137 (49.64%), Postives = 95/137 (69.34%), Query Frame = -3
Query:  182 GPITQDWEPVVIXXXXXXXXXXXXXKVVNAARRAGADIETVRKSHAGTNKAASSSTS--LNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTKLERALGVKLR 586
            G +TQDWEPVV+             K VNAA R G  ++TV+K  AG+NK   S+    +NT+KL+E+TE  A DRV +E++  I +AR +KK++Q+ LA+ INE+ QV+QEYE+GKA+PNQ +L K+E+ LGVKLR
Sbjct:    7 GAVTQDWEPVVLHKSKQKSQDLRDPKAVNAALRNGVAVQTVKKFDAGSNKKGKSTAVPVINTKKLEEETEPAAMDRVKAEVRLMIQKARLEKKMSQADLAKQINERTQVVQEYENGKAVPNQAVLAKMEKVLGVKLR 143          
BLAST of CN181473 vs. ExPASy Swiss-Prot
Match: EDF1_DANRE (Endothelial differentiation-related factor 1 homolog OS=Danio rerio GN=edf1 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 5.956e-26
Identity = 63/130 (48.46%), Postives = 80/130 (61.54%), Query Frame = -3
Query:  182 DWEPVVIXXXXXXXXXXXXXKVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTKLERALGVKLR 571
            DW+ V +             + V AA+R G  +ET +K  AG NK      + NT KLD +TE L+H RVP E+ K I Q R +K LTQ  LA  INEKPQ+I EYE GKAIPN Q++ K+ERA+G+KLR
Sbjct:    5 DWDTVTVLRKKGSAAQSKSKQAVTAAQRKGEAVETSKKWAAGQNK--QHVVTKNTAKLDRETEELSHQRVPLEVGKVIQQGRQNKGLTQKDLATKINEKPQIIAEYECGKAIPNNQVMGKIERAIGLKLR 132          
BLAST of CN181473 vs. ExPASy Swiss-Prot
Match: EDF1_HUMAN (Endothelial differentiation-related factor 1 OS=Homo sapiens GN=EDF1 PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.733e-25
Identity = 66/131 (50.38%), Postives = 82/131 (62.60%), Query Frame = -3
Query:  182 DWEPV-VIXXXXXXXXXXXXXKVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTKLERALGVKLR 571
            DW+ V V+             + + AA+R G D+ET +K  AG NK    S + NT KLD +TE L HDRV  E+ K I Q R  K LTQ  LA  INEKPQVI +YESG+AIPN Q+L K+ERA+G+KLR
Sbjct:    5 DWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK--QHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLR 133          
BLAST of CN181473 vs. ExPASy Swiss-Prot
Match: EDF1_BOVIN (Endothelial differentiation-related factor 1 OS=Bos taurus GN=EDF1 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.733e-25
Identity = 66/131 (50.38%), Postives = 82/131 (62.60%), Query Frame = -3
Query:  182 DWEPV-VIXXXXXXXXXXXXXKVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTKLERALGVKLR 571
            DW+ V V+             + + AA+R G D+ET +K  AG NK    S + NT KLD +TE L HDRV  E+ K I Q R  K LTQ  LA  INEKPQVI +YESG+AIPN Q+L K+ERA+G+KLR
Sbjct:    5 DWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK--QHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLR 133          
BLAST of CN181473 vs. ExPASy Swiss-Prot
Match: EDF1_CHICK (Endothelial differentiation-related factor 1 homolog OS=Gallus gallus GN=EDF1 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.263e-25
Identity = 65/131 (49.62%), Postives = 82/131 (62.60%), Query Frame = -3
Query:  182 DWEPV-VIXXXXXXXXXXXXXKVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTKLERALGVKLR 571
            DW+ V V+             + V AA+R G D+ET +K  AG NK      + NT KLD +TE L HDRVP E+ K I Q R  K +TQ  LA  INEKPQVI +YESG+AIPN Q++ K+ERA+G+KLR
Sbjct:    5 DWDTVTVLRKKGPSAAQAKSKQAVLAAQRRGEDVETSKKWAAGQNK--QHFITKNTAKLDRETEELHHDRVPLEVGKVIQQGRQSKGMTQKDLATKINEKPQVIADYESGRAIPNNQVMGKIERAIGLKLR 133          
BLAST of CN181473 vs. ExPASy Swiss-Prot
Match: EDF1_RAT (Endothelial differentiation-related factor 1 OS=Rattus norvegicus GN=Edf1 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 5.042e-25
Identity = 65/131 (49.62%), Postives = 82/131 (62.60%), Query Frame = -3
Query:  182 DWEPV-VIXXXXXXXXXXXXXKVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTKLERALGVKLR 571
            DW+ V V+             + + AA+R G D+ET +K  AG NK    S + NT KLD +TE L HDRV  E+ K I + R  K LTQ  LA  INEKPQVI +YESG+AIPN Q+L K+ERA+G+KLR
Sbjct:    5 DWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK--QHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLR 133          
BLAST of CN181473 vs. ExPASy Swiss-Prot
Match: EDF1_MOUSE (Endothelial differentiation-related factor 1 OS=Mus musculus GN=Edf1 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 5.042e-25
Identity = 65/131 (49.62%), Postives = 82/131 (62.60%), Query Frame = -3
Query:  182 DWEPV-VIXXXXXXXXXXXXXKVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTKLERALGVKLR 571
            DW+ V V+             + + AA+R G D+ET +K  AG NK    S + NT KLD +TE L HDRV  E+ K I + R  K LTQ  LA  INEKPQVI +YESG+AIPN Q+L K+ERA+G+KLR
Sbjct:    5 DWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK--QHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLR 133          
BLAST of CN181473 vs. ExPASy Swiss-Prot
Match: EDF1_XENLA (Endothelial differentiation-related factor 1 homolog OS=Xenopus laevis GN=edf1 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 8.600e-25
Identity = 62/131 (47.33%), Postives = 81/131 (61.83%), Query Frame = -3
Query:  182 DWEPV-VIXXXXXXXXXXXXXKVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTKLERALGVKLR 571
            DW+ V V+             + + AA+R G ++ET +K  AG NK    + + NT KLD +TE L HDRVP E+ K I Q R  K +TQ  LA  INEKPQVI +YE GKAIPN Q++ K+ER +G+KLR
Sbjct:    5 DWDTVTVLRKKGPTAAQAKSKQAITAAQRRGEEVETSKKWSAGQNK--QHTITRNTAKLDRETEELHHDRVPLEVGKVIQQGRQGKGMTQKDLATKINEKPQVIADYECGKAIPNNQVMGKIERVIGLKLR 133          
The following BLAST results are available for this feature:
BLAST of CN181473 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
MBF1B_ARATH3.031e-5479.14Multiprotein-bridging factor 1b OS=Arabidopsis tha... [more]
MBF1A_ARATH3.031e-5479.14Multiprotein-bridging factor 1a OS=Arabidopsis tha... [more]
MBF1C_ARATH3.986e-3049.64Multiprotein-bridging factor 1c OS=Arabidopsis tha... [more]
EDF1_DANRE5.956e-2648.46Endothelial differentiation-related factor 1 homol... [more]
EDF1_HUMAN1.733e-2550.38Endothelial differentiation-related factor 1 OS=Ho... [more]
EDF1_BOVIN1.733e-2550.38Endothelial differentiation-related factor 1 OS=Bo... [more]
EDF1_CHICK2.263e-2549.62Endothelial differentiation-related factor 1 homol... [more]
EDF1_RAT5.042e-2549.62Endothelial differentiation-related factor 1 OS=Ra... [more]
EDF1_MOUSE5.042e-2549.62Endothelial differentiation-related factor 1 OS=Mu... [more]
EDF1_XENLA8.600e-2547.33Endothelial differentiation-related factor 1 homol... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A01_r Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181473 ID=CN181473|Name=CN181473|organism=Citrus sinensis|type=EST|length=639bp
GAGGTAAAAGGCTTAATAGATTCAGTCGTGACAAGAGTAACAGTCAAGGA
CACTAGTTATGTGCCGAGCCATAACCATAGGAGAAAACATTCATATACAG
CACCCATTTTGAAGACTCAACAACAGGACACAACATCAAGTCCCGGTAGA
AGTTTTTATTTATCCCTCCTCACTTCTTTCCTCGAAGCTTCACACCAAGG
GCCCTCTCCAGCTTGGTAAGTATCTGCTGATTTGGAATGGCTTTTCCTGA
TTCATATTCCTGAATCACCTGGGGCTTCTCATTGATCAACTGAGCAAGTT
GAGACTGGGTAAGTTTCTTATCATTTCGTGCCTGAACAATGGCTTTCTTG
AGTTCGCTAGGCACTCGATCATGAGCAAGGTTCTCTGTATCTTCATCAAG
CTTCCTGGTGTTCAGAGAAGTGCTACTCGAGGCAGCCTTGTTTGTGCCAG
CATGTGATTTTCTGACAGTCTCGATATCGGCACCGGCGCGTCGGGCAGCG
TTAACGACCTTCTCGTCCTTCTTGGCGGCGGCGTTGGGGGCTTTCTTCTT
AATCACCACCGGCTCCCAGTCCTGTGTGATCGGTCCGATTCCGGCCATGT
CCACTCCTCGATCAAATATCTCTTCACTTAAAAGATTTT
back to top