CN181472

Overview
NameCN181472
Unique NameCN181472
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length509
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2887 contig Csv1_Contig2887:84..589. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN181472 vs. ExPASy Swiss-Prot
Match: MBF1B_ARATH (Multiprotein-bridging factor 1b OS=Arabidopsis thaliana GN=MBF1B PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.275e-55
Identity = 111/142 (78.17%), Postives = 121/142 (85.21%), Query Frame = 3
Query:   42 MAGIGPITQDWEPVVIXXXXXXXXXXXXXXVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTMLERALGVKLRGKK 467
            MAGIGPITQDWEPVVI               VNAARR+GADIETVRK +AG+NKAASS TSLNT+KLD+DTENL+HDRVP+ELKKAI+QAR +KKLTQSQLA LINEKPQVIQEYESGKAIPNQQIL+ LERALG KLRGKK
Sbjct:    1 MAGIGPITQDWEPVVIRKRAPNAAAKRDEKTVNAARRSGADIETVRKFNAGSNKAASSGTSLNTKKLDDDTENLSHDRVPTELKKAIMQARGEKKLTQSQLAHLINEKPQVIQEYESGKAIPNQQILSKLERALGAKLRGKK 142          
BLAST of CN181472 vs. ExPASy Swiss-Prot
Match: MBF1A_ARATH (Multiprotein-bridging factor 1a OS=Arabidopsis thaliana GN=MBF1A PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.275e-55
Identity = 111/142 (78.17%), Postives = 120/142 (84.51%), Query Frame = 3
Query:   42 MAGIGPITQDWEPVVIXXXXXXXXXXXXXXVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTMLERALGVKLRGKK 467
            MAGIGPITQDWEPVVI               VNAARR+GADIETVRK +AGTNKAASS TSLNT+ LD+DTENL H+RVP+ELKKAI+QAR DKKLTQSQLAQ+INEKPQVIQEYESGKAIPNQQIL+ LERALG KLRGKK
Sbjct:    1 MAGIGPITQDWEPVVIRKKPANAAAKRDEKTVNAARRSGADIETVRKFNAGTNKAASSGTSLNTKMLDDDTENLTHERVPTELKKAIMQARTDKKLTQSQLAQIINEKPQVIQEYESGKAIPNQQILSKLERALGAKLRGKK 142          
BLAST of CN181472 vs. ExPASy Swiss-Prot
Match: MBF1C_ARATH (Multiprotein-bridging factor 1c OS=Arabidopsis thaliana GN=MBF1C PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 6.372e-31
Identity = 68/139 (48.92%), Postives = 95/139 (68.35%), Query Frame = 3
Query:   54 GPITQDWEPVVIXXXXXXXXXXXXXXVVNAARRAGADIETVRKSHAGTNKAASSSTS--LNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTMLERALGVKLRGK 464
            G +TQDWEPVV+               VNAA R G  ++TV+K  AG+NK   S+    +NT+KL+E+TE  A DRV +E++  I +AR +KK++Q+ LA+ INE+ QV+QEYE+GKA+PNQ +L  +E+ LGVKLRGK
Sbjct:    7 GAVTQDWEPVVLHKSKQKSQDLRDPKAVNAALRNGVAVQTVKKFDAGSNKKGKSTAVPVINTKKLEEETEPAAMDRVKAEVRLMIQKARLEKKMSQADLAKQINERTQVVQEYENGKAVPNQAVLAKMEKVLGVKLRGK 145          
BLAST of CN181472 vs. ExPASy Swiss-Prot
Match: EDF1_DANRE (Endothelial differentiation-related factor 1 homolog OS=Danio rerio GN=edf1 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 7.290e-27
Identity = 65/135 (48.15%), Postives = 81/135 (60.00%), Query Frame = 3
Query:   69 DWEPVVIXXXXXXXXXXXXXXVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTMLERALGVKLRGKK*G 473
            DW+ V +               V AA+R G  +ET +K  AG NK      + NT KLD +TE L+H RVP E+ K I Q R +K LTQ  LA  INEKPQ+I EYE GKAIPN Q++  +ERA+G+KLRGK  G
Sbjct:    5 DWDTVTVLRKKGSAAQSKSKQAVTAAQRKGEAVETSKKWAAGQNK--QHVVTKNTAKLDRETEELSHQRVPLEVGKVIQQGRQNKGLTQKDLATKINEKPQIIAEYECGKAIPNNQVMGKIERAIGLKLRGKDIG 137          
BLAST of CN181472 vs. ExPASy Swiss-Prot
Match: EDF1_HUMAN (Endothelial differentiation-related factor 1 OS=Homo sapiens GN=EDF1 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.244e-26
Identity = 68/137 (49.64%), Postives = 84/137 (61.31%), Query Frame = 3
Query:   69 DWEPV-VIXXXXXXXXXXXXXXVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTMLERALGVKLRGKK*GR 476
            DW+ V V+               + AA+R G D+ET +K  AG NK    S + NT KLD +TE L HDRV  E+ K I Q R  K LTQ  LA  INEKPQVI +YESG+AIPN Q+L  +ERA+G+KLRGK  G+
Sbjct:    5 DWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK--QHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGK 139          
BLAST of CN181472 vs. ExPASy Swiss-Prot
Match: EDF1_BOVIN (Endothelial differentiation-related factor 1 OS=Bos taurus GN=EDF1 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.244e-26
Identity = 68/137 (49.64%), Postives = 84/137 (61.31%), Query Frame = 3
Query:   69 DWEPV-VIXXXXXXXXXXXXXXVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTMLERALGVKLRGKK*GR 476
            DW+ V V+               + AA+R G D+ET +K  AG NK    S + NT KLD +TE L HDRV  E+ K I Q R  K LTQ  LA  INEKPQVI +YESG+AIPN Q+L  +ERA+G+KLRGK  G+
Sbjct:    5 DWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK--QHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGK 139          
BLAST of CN181472 vs. ExPASy Swiss-Prot
Match: EDF1_CHICK (Endothelial differentiation-related factor 1 homolog OS=Gallus gallus GN=EDF1 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.624e-26
Identity = 67/137 (48.91%), Postives = 84/137 (61.31%), Query Frame = 3
Query:   69 DWEPV-VIXXXXXXXXXXXXXXVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTMLERALGVKLRGKK*GR 476
            DW+ V V+               V AA+R G D+ET +K  AG NK      + NT KLD +TE L HDRVP E+ K I Q R  K +TQ  LA  INEKPQVI +YESG+AIPN Q++  +ERA+G+KLRGK  G+
Sbjct:    5 DWDTVTVLRKKGPSAAQAKSKQAVLAAQRRGEDVETSKKWAAGQNK--QHFITKNTAKLDRETEELHHDRVPLEVGKVIQQGRQSKGMTQKDLATKINEKPQVIADYESGRAIPNNQVMGKIERAIGLKLRGKDIGK 139          
BLAST of CN181472 vs. ExPASy Swiss-Prot
Match: EDF1_RAT (Endothelial differentiation-related factor 1 OS=Rattus norvegicus GN=Edf1 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 3.618e-26
Identity = 67/137 (48.91%), Postives = 84/137 (61.31%), Query Frame = 3
Query:   69 DWEPV-VIXXXXXXXXXXXXXXVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTMLERALGVKLRGKK*GR 476
            DW+ V V+               + AA+R G D+ET +K  AG NK    S + NT KLD +TE L HDRV  E+ K I + R  K LTQ  LA  INEKPQVI +YESG+AIPN Q+L  +ERA+G+KLRGK  G+
Sbjct:    5 DWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK--QHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGK 139          
BLAST of CN181472 vs. ExPASy Swiss-Prot
Match: EDF1_MOUSE (Endothelial differentiation-related factor 1 OS=Mus musculus GN=Edf1 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 3.618e-26
Identity = 67/137 (48.91%), Postives = 84/137 (61.31%), Query Frame = 3
Query:   69 DWEPV-VIXXXXXXXXXXXXXXVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTMLERALGVKLRGKK*GR 476
            DW+ V V+               + AA+R G D+ET +K  AG NK    S + NT KLD +TE L HDRV  E+ K I + R  K LTQ  LA  INEKPQVI +YESG+AIPN Q+L  +ERA+G+KLRGK  G+
Sbjct:    5 DWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK--QHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGK 139          
BLAST of CN181472 vs. ExPASy Swiss-Prot
Match: EDF1_XENLA (Endothelial differentiation-related factor 1 homolog OS=Xenopus laevis GN=edf1 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 6.172e-26
Identity = 64/137 (46.72%), Postives = 83/137 (60.58%), Query Frame = 3
Query:   69 DWEPV-VIXXXXXXXXXXXXXXVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLAHDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTMLERALGVKLRGKK*GR 476
            DW+ V V+               + AA+R G ++ET +K  AG NK    + + NT KLD +TE L HDRVP E+ K I Q R  K +TQ  LA  INEKPQVI +YE GKAIPN Q++  +ER +G+KLRGK  G+
Sbjct:    5 DWDTVTVLRKKGPTAAQAKSKQAITAAQRRGEEVETSKKWSAGQNK--QHTITRNTAKLDRETEELHHDRVPLEVGKVIQQGRQGKGMTQKDLATKINEKPQVIADYECGKAIPNNQVMGKIERVIGLKLRGKDIGK 139          
The following BLAST results are available for this feature:
BLAST of CN181472 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
MBF1B_ARATH1.275e-5578.17Multiprotein-bridging factor 1b OS=Arabidopsis tha... [more]
MBF1A_ARATH1.275e-5578.17Multiprotein-bridging factor 1a OS=Arabidopsis tha... [more]
MBF1C_ARATH6.372e-3148.92Multiprotein-bridging factor 1c OS=Arabidopsis tha... [more]
EDF1_DANRE7.290e-2748.15Endothelial differentiation-related factor 1 homol... [more]
EDF1_HUMAN1.244e-2649.64Endothelial differentiation-related factor 1 OS=Ho... [more]
EDF1_BOVIN1.244e-2649.64Endothelial differentiation-related factor 1 OS=Bo... [more]
EDF1_CHICK1.624e-2648.91Endothelial differentiation-related factor 1 homol... [more]
EDF1_RAT3.618e-2648.91Endothelial differentiation-related factor 1 OS=Ra... [more]
EDF1_MOUSE3.618e-2648.91Endothelial differentiation-related factor 1 OS=Mu... [more]
EDF1_XENLA6.172e-2646.72Endothelial differentiation-related factor 1 homol... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS04_0001A01_f Ruby Orange Developing Flower cDNA Library Citrus sinensis cDNA clone CS_REb0001A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN181472 ID=CN181472|Name=CN181472|organism=Citrus sinensis|type=EST|length=509bp
CCCCAAACTTTTAGTGAAGAGAATTTGATCGAGGAGTGGACATGGCCGGA
ATCGGACCGATCACACAGGACTGGGAGCCGGTGGTGATTAAGAAGAAAGC
CCCCAACGCCGCCGCCAAGAAGGACGAGAAGGTCGTTAACGCTGCCCGAC
GCGCCGGTGCCGATATCGAGACTGTCAGAAAATCACATGCTGGCACAAAC
AAGGCTGCCTCGAGTAGCACTTCTCTGAACACCAGGAAGCTTGATGAAGA
TACAGAGAACCTTGCTCATGATCGAGTGCCTAGCGAACTCAAGAAAGCCA
TTGTTCAGGCACGAAATGATAAGAAACTTACCCAGTCTCAACTTGCTCAG
TTGATCAATGAGAAGCCCCAGGTGATTCAGGAATATGAATCAGGAAAAGC
CATTCCTAATCAGCAGATACTTACCATGCTGGAGAGGGCCCTTGGTGTGA
AGCTTCGAGGAAAGAAGTGAGGGAGGGATAAAATAATAACTTCTACCGGG
ACTTGATGT
back to top