CN188447

Overview
NameCN188447
Unique NameCN188447
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length733
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN188447 vs. ExPASy Swiss-Prot
Match: RPB2_ARATH (DNA-directed RNA polymerase II subunit RPB2 OS=Arabidopsis thaliana GN=RPB135 PE=2 SV=2)

HSP 1 Score: 483.411 bits (1243), Expect = 5.327e-136
Identity = 235/242 (97.11%), Postives = 240/242 (99.17%), Query Frame = 2
Query:    5 PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAIACYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRSNTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPISQDEAQGQASRYTRRDHSISLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTVESITP 730
            PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAI+CYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDR +TMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPISQDEAQGQ+SRYTRRDHSISLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWT+E +TP
Sbjct:  728 PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAISCYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRGSTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPISQDEAQGQSSRYTRRDHSISLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTIEGVTP 969          
BLAST of CN188447 vs. ExPASy Swiss-Prot
Match: RPB2_SOLLC (DNA-directed RNA polymerase II subunit RPB2 OS=Solanum lycopersicum GN=RPB2 PE=2 SV=1)

HSP 1 Score: 481.485 bits (1238), Expect = 2.024e-135
Identity = 235/242 (97.11%), Postives = 240/242 (99.17%), Query Frame = 2
Query:    5 PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAIACYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRSNTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPISQDEAQGQASRYTRRDHSISLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTVESITP 730
            PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAI+CYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDR++TMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPISQD+AQGQASRYTR+DHS SLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTVE ITP
Sbjct:  727 PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAISCYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRASTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPISQDDAQGQASRYTRKDHSTSLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTVEGITP 968          
BLAST of CN188447 vs. ExPASy Swiss-Prot
Match: RPB2_YEAST (DNA-directed RNA polymerase II subunit RPB2 OS=Saccharomyces cerevisiae GN=RPB2 PE=1 SV=2)

HSP 1 Score: 363.999 bits (933), Expect = 4.710e-100
Identity = 178/244 (72.95%), Postives = 208/244 (85.25%), Query Frame = 2
Query:    5 PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAIACYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRSNTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPISQDEAQ-GQASRY-TRRDHSISLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTVESITP 730
            PRNTYQSAMGKQAMG+++TNY  RMDT+A +LYYPQKPL TTRAME+L FR+LPAG NAIVAIACYSGYNQEDS+IMNQSSIDRG FRSLFFRSY D+EKK G  + E F +P R+NT+ M+HG+YDKLDDDGL  PG RVSGEDVIIGKTTPIS DE + GQ + Y ++RD S  LR +E G+VDQVL+TTN DGL+FVKVRVR+ +IPQIGDKF+SRHGQKGT+G+TY +EDMP+T E I P
Sbjct:  765 PRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVP 1008          
BLAST of CN188447 vs. ExPASy Swiss-Prot
Match: RPB2_CANGA (DNA-directed RNA polymerase II subunit RPB2 OS=Candida glabrata GN=RPB2 PE=3 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 6.151e-100
Identity = 175/244 (71.72%), Postives = 209/244 (85.66%), Query Frame = 2
Query:    5 PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAIACYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRSNTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPISQDEAQ-GQASRY-TRRDHSISLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTVESITP 730
            PRNTYQSAMGKQAMG+++TNY FRMDT+A +LYYPQKPL TTRAME+L FR+LPAG NAIVAIACYSGYNQEDS+IMNQSSIDRG FRSLFFRSY D+EKK G  + E F +P R+NT+ M+HG+YDKLD+DGL  PG RVSGED+IIGKTTPI+ DE + GQ + Y ++RD S  LR +E G+VDQVL+TTN DGL+FVKVRVR+ ++PQIGDKF+SRHGQKGT+G+TY +EDMP+T E I P
Sbjct:  764 PRNTYQSAMGKQAMGVFLTNYNFRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDEDGLIAPGVRVSGEDIIIGKTTPIAPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLITTNQDGLKFVKVRVRTTKVPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVP 1007          
BLAST of CN188447 vs. ExPASy Swiss-Prot
Match: RPB2_DICDI (DNA-directed RNA polymerase II subunit rpb2 OS=Dictyostelium discoideum GN=polr2b PE=3 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 3.987e-99
Identity = 168/244 (68.85%), Postives = 209/244 (85.66%), Query Frame = 2
Query:    5 PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAIACYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRSNTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPI--SQDEAQGQASRYTRRDHSISLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTVESITP 730
            PRNTYQ+AMGKQAMG+Y+TNYQ RMDT+A+VL+YPQKPLVTTR+ME+LHFR+LPAG N  VAIACYSGYNQEDSVI+NQS+IDRG FRS+F+R+Y+DE+KK  +L++E F +P+R    GMRHGSY+K+DDDGL  PG RV+G+D+IIGKTTP+  S D+   +  R+T+RD S +LR SETG+VDQV+LTT+ +G +F KVRVRS+R+PQIGDKFSSRHGQKGT GM Y QED+P+TVE I P
Sbjct:  716 PRNTYQAAMGKQAMGVYITNYQLRMDTMAHVLFYPQKPLVTTRSMEYLHFRELPAGQNVCVAIACYSGYNQEDSVILNQSAIDRGLFRSMFYRAYKDEQKKQTSLMEEVFEKPERDTCAGMRHGSYEKIDDDGLVAPGVRVAGDDIIIGKTTPLPPSDDDLGPKTRRHTKRDSSTALRSSETGIVDQVILTTSGEGFKFCKVRVRSMRVPQIGDKFSSRHGQKGTCGMAYRQEDLPFTVEGIVP 959          
BLAST of CN188447 vs. ExPASy Swiss-Prot
Match: RPB2_SCHPO (DNA-directed RNA polymerase II subunit RPB2 OS=Schizosaccharomyces pombe GN=rpb2 PE=1 SV=2)

HSP 1 Score: 353.599 bits (906), Expect = 6.366e-97
Identity = 170/244 (69.67%), Postives = 207/244 (84.84%), Query Frame = 2
Query:    5 PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAIACYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRSNTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPISQD-EAQGQASR-YTRRDHSISLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTVESITP 730
            PRNTYQSAMGKQAMG+Y+TNYQ RMDT+A +LYYPQKPL TTR+ME+L FR+LPAG NAIVAI CYSGYNQEDS+IMNQ+SIDRG FRS+F+R+Y D+EKK+G  V E+F RP RS T+ M+HG+YDKL+DDGL  PGTRVSGED+IIGKT PI  D E  GQ ++ + +RD S  LR +E+G+VDQV++TTN +GL+FVKVR+RS RIPQIGDKF+SRHGQKGT+GMTY  EDMP++ + I P
Sbjct:  754 PRNTYQSAMGKQAMGVYLTNYQVRMDTMANILYYPQKPLATTRSMEYLKFRELPAGQNAIVAILCYSGYNQEDSIIMNQASIDRGLFRSIFYRTYTDQEKKIGMTVMEEFERPVRSTTLRMKHGTYDKLEDDGLIAPGTRVSGEDIIIGKTAPIPLDHEELGQRTQLHAKRDVSTPLRSTESGIVDQVMVTTNQEGLKFVKVRMRSTRIPQIGDKFASRHGQKGTIGMTYRHEDMPFSAQGIVP 997          
BLAST of CN188447 vs. ExPASy Swiss-Prot
Match: RPB2_PICGU (DNA-directed RNA polymerase II subunit RPB2 OS=Pichia guilliermondii GN=RPB2 PE=3 SV=3)

HSP 1 Score: 353.214 bits (905), Expect = 8.314e-97
Identity = 172/244 (70.49%), Postives = 204/244 (83.61%), Query Frame = 2
Query:    5 PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAIACYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRSNTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPISQD-EAQGQASRY-TRRDHSISLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTVESITP 730
            PRNTYQSAMGKQAMG+++TNY  RMDT+A +LYYPQKPL TTRAMEHL FR+LPAG NAIVAIACYSGYNQEDS+IMNQSSIDRG FRSLFFR+Y D EK+ G    E F +P RS+T+ ++HG+Y+KLDDDGL  PG RVSGED+IIGKTTPI  D E  GQ ++Y T+RD S  LR +E+G+VDQVLLTTN DG +FVKVR+R+ ++PQIGDKF+SRHGQKGTVG+TY  EDMP+T + I P
Sbjct:  774 PRNTYQSAMGKQAMGVFLTNYSVRMDTMANILYYPQKPLATTRAMEHLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRTYMDLEKRQGMKALETFEKPSRSDTLRLKHGTYEKLDDDGLIAPGIRVSGEDIIIGKTTPIPPDTEELGQRTQYHTKRDASTPLRSTESGIVDQVLLTTNGDGAKFVKVRMRTTKVPQIGDKFASRHGQKGTVGVTYRHEDMPFTSQGIVP 1017          
BLAST of CN188447 vs. ExPASy Swiss-Prot
Match: RPB2_ASHGO (DNA-directed RNA polymerase II subunit RPB2 OS=Ashbya gossypii GN=RPB2 PE=3 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 3.159e-96
Identity = 168/244 (68.85%), Postives = 206/244 (84.43%), Query Frame = 2
Query:    5 PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAIACYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRSNTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTTPISQD-EAQGQASRY-TRRDHSISLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTVESITP 730
            PRNTYQSAMGKQAMG+++TNY  RMDT+A +LYYPQKPL TTRAME+L FR+LPAG NAIVAIACYSGYNQEDS+IMNQSSID G FRSLFFRSY D+EK++G  + E F +P R+NT+ M+HG+Y+KLDDDGL  PG RVSG+D+IIGKTTPI  D E  GQ + + ++RD S  LR +E G+VDQVL+TTN +GL+FVKVRVR+ ++PQIGDKF+SRHGQKGT+G+TY +EDMP+T E + P
Sbjct:  763 PRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDSGLFRSLFFRSYMDQEKRIGMSITESFEKPHRTNTLRMKHGTYEKLDDDGLIAPGVRVSGDDIIIGKTTPIPPDAEELGQRTAFHSKRDASTPLRSTENGIVDQVLITTNQEGLKFVKVRVRTTKVPQIGDKFASRHGQKGTIGITYRREDMPFTAEGVVP 1006          
BLAST of CN188447 vs. ExPASy Swiss-Prot
Match: RPB2_HUMAN (DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens GN=POLR2B PE=1 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.327e-94
Identity = 168/244 (68.85%), Postives = 201/244 (82.38%), Query Frame = 2
Query:    5 PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAIACYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRSNTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTT--PISQDEAQGQASRYTRRDHSISLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTVESITP 730
            PRNTYQSAMGKQAMG+Y+TN+  RMDTLA+VLYYPQKPLVTTR+ME+L FR+LPAGIN+IVAIA Y+GYNQEDSVIMN+S++DRGFFRS+F+RSY+++E K G   +E F +P R    GMRH  YDKLDDDGL  PG RVSG+DVIIGKT   P ++DE +    RYT+RD S  LR SETG+VDQV++T N +G +F K+RVRSVRIPQIGDKF+SRHGQKGT G+ Y QEDMP+T E ITP
Sbjct:  720 PRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITP 963          
BLAST of CN188447 vs. ExPASy Swiss-Prot
Match: RPB2_MOUSE (DNA-directed RNA polymerase II subunit RPB2 OS=Mus musculus GN=Polr2b PE=2 SV=2)

HSP 1 Score: 344.354 bits (882), Expect = 3.862e-94
Identity = 167/244 (68.44%), Postives = 201/244 (82.38%), Query Frame = 2
Query:    5 PRNTYQSAMGKQAMGIYVTNYQFRMDTLAYVLYYPQKPLVTTRAMEHLHFRQLPAGINAIVAIACYSGYNQEDSVIMNQSSIDRGFFRSLFFRSYRDEEKKMGTLVKEDFGRPDRSNTMGMRHGSYDKLDDDGLAPPGTRVSGEDVIIGKTT--PISQDEAQGQASRYTRRDHSISLRHSETGMVDQVLLTTNADGLRFVKVRVRSVRIPQIGDKFSSRHGQKGTVGMTYTQEDMPWTVESITP 730
            PRNTYQSAMGKQAMG+Y+TN+  RMDTLA+VLYYPQKPLVTTR+ME+L FR+LPAGIN+IVAIA Y+GYNQEDSVIMN+S++DRGFFRS+F+RSY+++E K G   +E F +P R    GMRH  Y+KLDDDGL  PG RVSG+DVIIGKT   P ++DE +    RYT+RD S  LR SETG+VDQV++T N +G +F K+RVRSVRIPQIGDKF+SRHGQKGT G+ Y QEDMP+T E ITP
Sbjct:  720 PRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYEKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITP 963          
The following BLAST results are available for this feature:
BLAST of CN188447 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 343
Match NameE-valueIdentityDescription
RPB2_ARATH5.327e-13697.11DNA-directed RNA polymerase II subunit RPB2 OS=Ara... [more]
RPB2_SOLLC2.024e-13597.11DNA-directed RNA polymerase II subunit RPB2 OS=Sol... [more]
RPB2_YEAST4.710e-10072.95DNA-directed RNA polymerase II subunit RPB2 OS=Sac... [more]
RPB2_CANGA6.151e-10071.72DNA-directed RNA polymerase II subunit RPB2 OS=Can... [more]
RPB2_DICDI3.987e-9968.85DNA-directed RNA polymerase II subunit rpb2 OS=Dic... [more]
RPB2_SCHPO6.366e-9769.67DNA-directed RNA polymerase II subunit RPB2 OS=Sch... [more]
RPB2_PICGU8.314e-9770.49DNA-directed RNA polymerase II subunit RPB2 OS=Pic... [more]
RPB2_ASHGO3.159e-9668.85DNA-directed RNA polymerase II subunit RPB2 OS=Ash... [more]
RPB2_HUMAN1.327e-9468.85DNA-directed RNA polymerase II subunit RPB2 OS=Hom... [more]
RPB2_MOUSE3.862e-9468.44DNA-directed RNA polymerase II subunit RPB2 OS=Mus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006A20_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006A20, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188447 ID=CN188447; Name=CN188447; organism=Citrus sinensis; type=EST; length=733bp
GCGTCCACGTAACACGTATCAATCAGCTATGGGTAAGCAAGCCATGGGGA
TCTATGTCACCAACTACCAATTTCGTATGGATACTTTGGCGTATGTTCTC
TATTATCCTCAGAAGCCACTTGTTACTACGCGAGCAATGGAACACCTCCA
CTTCAGGCAGCTTCCGGCTGGCATTAATGCTATTGTCGCTATCGCTTGCT
ATTCTGGCTACAACCAAGAAGATTCTGTTATTATGAACCAATCGTCAATC
GACCGTGGGTTCTTTCGATCTCTTTTCTTCCGTTCATATAGAGATGAGGA
GAAAAAGATGGGGACCCTTGTTAAAGAAGATTTTGGACGTCCAGATAGAT
CTAATACTATGGGCATGCGGCATGGCTCTTATGATAAATTGGATGATGAT
GGTCTTGCGCCTCCTGGCACAAGGGTTTCTGGTGAGGATGTGATCATTGG
GAAGACCACTCCTATTTCTCAGGATGAAGCTCAAGGACAAGCGTCACGCT
ACACCAGACGGGATCATAGCATAAGCTTACGTCACAGTGAAACAGGGATG
GTGGATCAAGTTTTACTGACAACCAATGCTGATGGATTGAGGTTTGTGAA
AGTGAGAGTTAGATCTGTCCGTATACCCCAGATTGGAGACAAGTTTAGTA
GTAGGCATGGTCAGAAAGGAACTGTGGGCATGACTTACACTCAGGAAGAC
ATGCCGTGGACAGTGGAAAGCATCACCCCCTGA
back to top