CN188442
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO_RICCO (Enolase OS=Ricinus communis PE=2 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 6.011e-16 Identity = 39/45 (86.67%), Postives = 41/45 (91.11%), Query Frame = -3 Query: 243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377 GQIKTGAPCR ERLAKYNQLLRIE++LGAE VY GAKFR PVEPY Sbjct: 401 GQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRTPVEPY 445
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO_ORYSJ (Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE=1 SV=2) HSP 1 Score: 82.0333 bits (201), Expect = 1.025e-15 Identity = 39/45 (86.67%), Postives = 41/45 (91.11%), Query Frame = -3 Query: 243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377 GQIKTGAPCR ERLAKYNQLLRIE++LGA VY GAKFRAPVEPY Sbjct: 402 GQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY 446
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO2_MAIZE (Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 1.749e-15 Identity = 39/45 (86.67%), Postives = 41/45 (91.11%), Query Frame = -3 Query: 243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377 GQIKTGAPCR ERLAKYNQLLRIE++LGA VY GAKFRAPVEPY Sbjct: 402 GQIKTGAPCRSERLAKYNQLLRIEEELGAIAVYAGAKFRAPVEPY 446
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO2_HEVBR (Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 2.284e-15 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = -3 Query: 243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377 GQIKTGAPCR ERLAKYNQLLRIE++LGAE VY GA FR PVEPY Sbjct: 401 GQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY 445
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO_ALNGL (Enolase OS=Alnus glutinosa GN=PGH1 PE=2 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 5.089e-15 Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = -3 Query: 243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377 GQIKTGAPCR ERLAKYNQLLRIE++LG+E VY GA FR PVEPY Sbjct: 396 GQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRTPVEPY 440
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO1_MAIZE (Enolase 1 OS=Zea mays GN=ENO1 PE=2 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 5.089e-15 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = -3 Query: 243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377 GQIKTGAPCR ERLAKYNQLLRIE++LG VY GAKFRAPVEPY Sbjct: 402 GQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRAPVEPY 446
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO_SOLLC (Enolase OS=Solanum lycopersicum GN=PGH1 PE=2 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.646e-15 Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = -3 Query: 243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377 GQIKTGAPCR ERLAKYNQLLRIE++LG+E VY GA FR PVEPY Sbjct: 400 GQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGASFRKPVEPY 444
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO1_HEVBR (Enolase 1 OS=Hevea brasiliensis GN=ENO1 PE=1 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.646e-15 Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = -3 Query: 243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377 GQIKTGAPCR ERLAKYNQLLRIE++LG+E VY GA FR PVEPY Sbjct: 401 GQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY 445
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO_ARATH (Enolase OS=Arabidopsis thaliana GN=ENO PE=1 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 2.526e-14 Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = -3 Query: 243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377 GQIKTGAPCR ERLAKYNQLLRIE++LG+E +Y G FR PVEPY Sbjct: 400 GQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRKPVEPY 444
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO_MESCR (Enolase OS=Mesembryanthemum crystallinum GN=PGH1 PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.308e-14 Identity = 36/45 (80.00%), Postives = 39/45 (86.67%), Query Frame = -3 Query: 243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377 GQIKTGAPCR ERLAKYNQLLRIE++LG + VY GA FR PVEPY Sbjct: 400 GQIKTGAPCRSERLAKYNQLLRIEEELGDKAVYAGANFRRPVEPY 444 The following BLAST results are available for this feature:
BLAST of CN188442 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN188442 ID=CN188442; Name=CN188442; organism=Citrus sinensis; type=EST; length=379bpback to top |