CN188442

Overview
NameCN188442
Unique NameCN188442
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length379
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO_RICCO (Enolase OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 6.011e-16
Identity = 39/45 (86.67%), Postives = 41/45 (91.11%), Query Frame = -3
Query:  243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377
            GQIKTGAPCR ERLAKYNQLLRIE++LGAE VY GAKFR PVEPY
Sbjct:  401 GQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRTPVEPY 445          
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO_ORYSJ (Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 1.025e-15
Identity = 39/45 (86.67%), Postives = 41/45 (91.11%), Query Frame = -3
Query:  243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377
            GQIKTGAPCR ERLAKYNQLLRIE++LGA  VY GAKFRAPVEPY
Sbjct:  402 GQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY 446          
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO2_MAIZE (Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.749e-15
Identity = 39/45 (86.67%), Postives = 41/45 (91.11%), Query Frame = -3
Query:  243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377
            GQIKTGAPCR ERLAKYNQLLRIE++LGA  VY GAKFRAPVEPY
Sbjct:  402 GQIKTGAPCRSERLAKYNQLLRIEEELGAIAVYAGAKFRAPVEPY 446          
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO2_HEVBR (Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.284e-15
Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = -3
Query:  243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377
            GQIKTGAPCR ERLAKYNQLLRIE++LGAE VY GA FR PVEPY
Sbjct:  401 GQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY 445          
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO_ALNGL (Enolase OS=Alnus glutinosa GN=PGH1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 5.089e-15
Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = -3
Query:  243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377
            GQIKTGAPCR ERLAKYNQLLRIE++LG+E VY GA FR PVEPY
Sbjct:  396 GQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRTPVEPY 440          
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO1_MAIZE (Enolase 1 OS=Zea mays GN=ENO1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 5.089e-15
Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = -3
Query:  243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377
            GQIKTGAPCR ERLAKYNQLLRIE++LG   VY GAKFRAPVEPY
Sbjct:  402 GQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRAPVEPY 446          
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO_SOLLC (Enolase OS=Solanum lycopersicum GN=PGH1 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.646e-15
Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = -3
Query:  243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377
            GQIKTGAPCR ERLAKYNQLLRIE++LG+E VY GA FR PVEPY
Sbjct:  400 GQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGASFRKPVEPY 444          
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO1_HEVBR (Enolase 1 OS=Hevea brasiliensis GN=ENO1 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.646e-15
Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = -3
Query:  243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377
            GQIKTGAPCR ERLAKYNQLLRIE++LG+E VY GA FR PVEPY
Sbjct:  401 GQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY 445          
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO_ARATH (Enolase OS=Arabidopsis thaliana GN=ENO PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.526e-14
Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = -3
Query:  243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377
            GQIKTGAPCR ERLAKYNQLLRIE++LG+E +Y G  FR PVEPY
Sbjct:  400 GQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRKPVEPY 444          
BLAST of CN188442 vs. ExPASy Swiss-Prot
Match: ENO_MESCR (Enolase OS=Mesembryanthemum crystallinum GN=PGH1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.308e-14
Identity = 36/45 (80.00%), Postives = 39/45 (86.67%), Query Frame = -3
Query:  243 GQIKTGAPCR*ERLAKYNQLLRIEKKLGAETVYVGAKFRAPVEPY 377
            GQIKTGAPCR ERLAKYNQLLRIE++LG + VY GA FR PVEPY
Sbjct:  400 GQIKTGAPCRSERLAKYNQLLRIEEELGDKAVYAGANFRRPVEPY 444          
The following BLAST results are available for this feature:
BLAST of CN188442 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
ENO_RICCO6.011e-1686.67Enolase OS=Ricinus communis PE=2 SV=1[more]
ENO_ORYSJ1.025e-1586.67Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE... [more]
ENO2_MAIZE1.749e-1586.67Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1[more]
ENO2_HEVBR2.284e-1584.44Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1[more]
ENO_ALNGL5.089e-1582.22Enolase OS=Alnus glutinosa GN=PGH1 PE=2 SV=1[more]
ENO1_MAIZE5.089e-1584.44Enolase 1 OS=Zea mays GN=ENO1 PE=2 SV=1[more]
ENO_SOLLC6.646e-1582.22Enolase OS=Solanum lycopersicum GN=PGH1 PE=2 SV=1[more]
ENO1_HEVBR6.646e-1582.22Enolase 1 OS=Hevea brasiliensis GN=ENO1 PE=1 SV=1[more]
ENO_ARATH2.526e-1477.78Enolase OS=Arabidopsis thaliana GN=ENO PE=1 SV=1[more]
ENO_MESCR4.308e-1480.00Enolase OS=Mesembryanthemum crystallinum GN=PGH1 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006A18_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006A18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188442 ID=CN188442; Name=CN188442; organism=Citrus sinensis; type=EST; length=379bp
TTTTTTTTTTTTTTTTTCCCGCACCGCAACTAGATACTCATTTTAATAAA
ACATGCTCCCTGAAATGGTTCCCCCTACAGCAAGGTTCAAGCTCTCAAAC
AAAAACTGTGTCAAAATTTTTGAGGAAATATCCCCGGTCACAAAATGCTA
AAAACCCATAAAAATCCTTTTTACATAACTTATTGAAGTAAACCTCCATT
GCTCAAATCCAGCACCACACCAGATCAGCATTTCAAACTCTAGTAGGGTT
CAACAGGGGCACGGAACTTGGCACCAACATAAACTGTTTCAGCACCAAGC
TTTTTTTCAATTCTCAAAAGCTGATTATACTTTGCAAGACGCTCTTACCT
GCATGGGGCTCCTGTCTTAATTTGACCCG
back to top