CN188441

Overview
NameCN188441
Unique NameCN188441
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length547
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN188441 vs. ExPASy Swiss-Prot
Match: UBC2_MEDSA (Ubiquitin-conjugating enzyme E2 2 OS=Medicago sativa GN=UBC2 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.089e-13
Identity = 34/39 (87.18%), Postives = 36/39 (92.31%), Query Frame = 3
Query:   12 CDPNPNSPANS*KARLFSENKREYNRRVREIVEQIWTAD 128
            CDPNPNSPANS  AR+FSENKREYNRRVRE+VEQ WTAD
Sbjct:  114 CDPNPNSPANSEAARMFSENKREYNRRVREVVEQSWTAD 152          
BLAST of CN188441 vs. ExPASy Swiss-Prot
Match: UBC2_ARATH (Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana GN=UBC2 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 4.140e-13
Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 3
Query:   12 CDPNPNSPANS*KARLFSENKREYNRRVREIVEQIWTAD 128
            CDPNPNSPANS  AR+FSE+KREYNRRVRE+VEQ WTAD
Sbjct:  114 CDPNPNSPANSEAARMFSESKREYNRRVREVVEQSWTAD 152          
BLAST of CN188441 vs. ExPASy Swiss-Prot
Match: UBC2_WHEAT (Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 5.406e-13
Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 3
Query:   12 CDPNPNSPANS*KARLFSENKREYNRRVREIVEQIWTAD 128
            CDPNPNSPANS  AR++SENKREYNR+VRE+VEQ WTAD
Sbjct:  114 CDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 152          
BLAST of CN188441 vs. ExPASy Swiss-Prot
Match: UBC1_ARATH (Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana GN=UBC1 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.054e-12
Identity = 31/39 (79.49%), Postives = 36/39 (92.31%), Query Frame = 3
Query:   12 CDPNPNSPANS*KARLFSENKREYNRRVREIVEQIWTAD 128
            CDPNPNSPANS  AR++SE+KREYNRRVR++VEQ WTAD
Sbjct:  114 CDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWTAD 152          
BLAST of CN188441 vs. ExPASy Swiss-Prot
Match: UBC2_DICDI (Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium discoideum GN=ubc2 PE=3 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 2.271e-11
Identity = 30/38 (78.95%), Postives = 34/38 (89.47%), Query Frame = 3
Query:   12 CDPNPNSPANS*KARLFSENKREYNRRVREIVEQIWTA 125
            CDPNPNSPANS  ARLF ENKREYNR+V+EIVEQ W++
Sbjct:  114 CDPNPNSPANSESARLFRENKREYNRKVKEIVEQSWSS 151          
The following BLAST results are available for this feature:
BLAST of CN188441 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
UBC2_MEDSA1.089e-1387.18Ubiquitin-conjugating enzyme E2 2 OS=Medicago sati... [more]
UBC2_ARATH4.140e-1384.62Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis t... [more]
UBC2_WHEAT5.406e-1382.05Ubiquitin-conjugating enzyme E2 2 OS=Triticum aest... [more]
UBC1_ARATH2.054e-1279.49Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis t... [more]
UBC2_DICDI2.271e-1178.95Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006A17_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006A17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188441 ID=CN188441; Name=CN188441; organism=Citrus sinensis; type=EST; length=547bp
GCGGTAAAGGGTGTGATCCAAATCCAAACTCCCCTGCAAATTCCTAAAAA
GCTCGGCTGTTTAGTGAGAATAAACGAGAGTACAACCGAAGAGTGCGTGA
AATAGTGGAGCAAATCTGGACAGCCGACTAAAAGTCCAATGAAAGCACCG
GCCGGTTATGCTGTAGAAATAAAAGATGAAAACTGGGGCTGGTGTGGCTG
GTTTGTTCAATAGTAGTGTACGCCGTAATCAATCTGATTTCAGGTGCATT
GTTATTAGAGAATCTCTTCGGATTCTTCCTCCCAGATAGCTCTGGTTGAA
CCTCTTGTTAATTTCTCAACATTTCCATCTTCTTTTCAACATCTTTCATG
TAACTGTAATTTATCTGTAGCATTTGTATAGGGGTATTATTGCTGCAGTG
AATCAGTGATGTATGTCTTAAGACAACCTCAGAGGAGCTCTTTTTCATTG
GAATTATTTAGTCGGATTTTTGGATGTTGTGAACGGCCATCTTGCATTGT
ATTTTTATGGTGATTGCTTATTCTGTCAAANAAAAAAAAAAAAAAAA
back to top