CN188435

Overview
NameCN188435
Unique NameCN188435
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length676
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN188435 vs. ExPASy Swiss-Prot
Match: 14338_ARATH (14-3-3-like protein GF14 kappa OS=Arabidopsis thaliana GN=GRF8 PE=2 SV=2)

HSP 1 Score: 363.614 bits (932), Expect = 5.322e-100
Identity = 181/212 (85.38%), Postives = 200/212 (94.34%), Query Frame = 1
Query:   40 TPTREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAFEEAIAELDTL 675
            T +R+QYVY+AKLAEQAERYEEMV+FM+ LV+ +TPA ELTVEERNLLSVAYKNVIGSLRAAWRI+SSIEQKEE RKNEEHVSLVKDYRSKVE+ELS +C  IL+LLDSHL+PSATA ESKVFYLKMKGDY+RYLAEFK GDERK AAE+TM++YKAAQD+A+ DLAPTHPIRLGLALNFSVFYYEILNSSEKAC+MAKQAFEEAIAELDTL
Sbjct:    4 TLSRDQYVYMAKLAEQAERYEEMVQFMEQLVSGATPAGELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNEEHVSLVKDYRSKVETELSSICSGILRLLDSHLIPSATASESKVFYLKMKGDYHRYLAEFKSGDERKTAAEDTMIAYKAAQDVAVADLAPTHPIRLGLALNFSVFYYEILNSSEKACSMAKQAFEEAIAELDTL 215          
BLAST of CN188435 vs. ExPASy Swiss-Prot
Match: 14336_ARATH (14-3-3-like protein GF14 lambda OS=Arabidopsis thaliana GN=GRF6 PE=1 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 4.505e-99
Identity = 181/209 (86.60%), Postives = 195/209 (93.30%), Query Frame = 1
Query:   49 REQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAFEEAIAELDTL 675
            R+QYVY+AKLAEQAERYEEMV+FM+ LVT +TPA ELTVEERNLLSVAYKNVIGSLRAAWRI+SSIEQKEE RKN+EHVSLVKDYRSKVESELS VC  ILKLLDSHL+PSA A ESKVFYLKMKGDY+RY+AEFK GDERK AAE+TML+YKAAQDIA  D+APTHPIRLGLALNFSVFYYEILNSS+KAC MAKQAFEEAIAELDTL
Sbjct:    7 RDQYVYMAKLAEQAERYEEMVQFMEQLVTGATPAEELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNDEHVSLVKDYRSKVESELSSVCSGILKLLDSHLIPSAGASESKVFYLKMKGDYHRYMAEFKSGDERKTAAEDTMLAYKAAQDIAAADMAPTHPIRLGLALNFSVFYYEILNSSDKACNMAKQAFEEAIAELDTL 215          
BLAST of CN188435 vs. ExPASy Swiss-Prot
Match: 1433D_TOBAC (14-3-3-like protein D OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 8.496e-98
Identity = 183/210 (87.14%), Postives = 197/210 (93.81%), Query Frame = 1
Query:   46 TREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAFEEAIAELDTL 675
            TREQ +YLAKLAEQAERYEEMVKFMD LV  S  ++ELTVEERNLLSVAYKNVIGSLRAAWRI+SSIEQKEEGRKNEEHV LVKDYRSKVESELSDVC  ILK+LD +L+PSA AGESKVFYLKMKGDYYRYLAEFKVG+ERK AAE+TML+YKAAQDIAL +LAPTHPIRLGLALN+SVFYYEILN+SEKAC+MAKQAFEEAIAELDTL
Sbjct:    8 TREQCLYLAKLAEQAERYEEMVKFMDRLVAVSA-SSELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEEGRKNEEHVVLVKDYRSKVESELSDVCAGILKILDQYLIPSAAAGESKVFYLKMKGDYYRYLAEFKVGNERKEAAEDTMLAYKAAQDIALAELAPTHPIRLGLALNYSVFYYEILNASEKACSMAKQAFEEAIAELDTL 216          
BLAST of CN188435 vs. ExPASy Swiss-Prot
Match: 14331_SOLLC (14-3-3 protein 1 OS=Solanum lycopersicum GN=TFT1 PE=3 SV=2)

HSP 1 Score: 354.755 bits (909), Expect = 2.472e-97
Identity = 181/210 (86.19%), Postives = 198/210 (94.29%), Query Frame = 1
Query:   46 TREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAFEEAIAELDTL 675
            TREQ +YLAKLAEQAERYEEMVKFMD LV  S  ++ELTVEERNLLSVAYKNVIGSLRAAWRI+SSIEQKEEGRKN+EHV LVKDYRSKVESELSDVC  ILK+LD +L+PSA+AGESKVFYLKMKGDYYRYLAEFKVG+ERK AAE+TML+YKAAQDIA+ +LAPTHPIRLGLALNFSVFYYEILN+SEKAC+MAKQAFEEAIAELDT+
Sbjct:    8 TREQCLYLAKLAEQAERYEEMVKFMDKLVIGSG-SSELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEEGRKNDEHVVLVKDYRSKVESELSDVCAGILKILDQYLIPSASAGESKVFYLKMKGDYYRYLAEFKVGNERKEAAEDTMLAYKAAQDIAVAELAPTHPIRLGLALNFSVFYYEILNASEKACSMAKQAFEEAIAELDTM 216          
BLAST of CN188435 vs. ExPASy Swiss-Prot
Match: 14310_SOLLC (14-3-3 protein 10 OS=Solanum lycopersicum GN=TFT10 PE=2 SV=2)

HSP 1 Score: 353.599 bits (906), Expect = 5.507e-97
Identity = 180/210 (85.71%), Postives = 195/210 (92.86%), Query Frame = 1
Query:   46 TREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAFEEAIAELDTL 675
            +REQ +YLAKLAEQAERYEEMV+FMD LV +STPA ELTVEERNLLSVAYKNVIGSLRAAWRI+SSIEQKEE RKNEEHV LVK+YR KVE+ELS VC  ILKLL+S+LVPSAT  ESKVFYLKMKGDYYRYLAEFK+GDERK AAE+TM SYKAAQ+IALTDL PTHPIRLGLALNFSVFY+EILNSS+KAC+MAKQAFEEAIAELDTL
Sbjct:   10 SREQCLYLAKLAEQAERYEEMVQFMDKLVLNSTPAGELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNEEHVHLVKEYRGKVENELSQVCAGILKLLESNLVPSATTSESKVFYLKMKGDYYRYLAEFKIGDERKQAAEDTMNSYKAAQEIALTDLPPTHPIRLGLALNFSVFYFEILNSSDKACSMAKQAFEEAIAELDTL 219          
BLAST of CN188435 vs. ExPASy Swiss-Prot
Match: 1433B_SOYBN (14-3-3-like protein B (Fragment) OS=Glycine max GN=GF14B PE=2 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 1.039e-95
Identity = 176/209 (84.21%), Postives = 192/209 (91.87%), Query Frame = 1
Query:   49 REQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAFEEAIAELDTL 675
            REQYVYLA ++EQAERYEEMV+FM  +V  STPA+ELTVEERNLLSVAYKNVIGSLRAAWRI+SSIEQKEEGRKN++HVSLVK YRSKVE+EL+ VC +IL LLDS+LVPSA+A ESKVFYLKMKGDY+RYLAEFKVGDERK A E+TMLSYKAAQDIA  DL PTHPIRLGLALNFSVFYYEILN S+KAC MAKQAFEEAIAELDTL
Sbjct:    6 REQYVYLANVSEQAERYEEMVEFMQKVVVGSTPASELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEEGRKNDDHVSLVKHYRSKVENELTQVCATILSLLDSNLVPSASASESKVFYLKMKGDYHRYLAEFKVGDERKTATEDTMLSYKAAQDIASADLPPTHPIRLGLALNFSVFYYEILNQSDKACAMAKQAFEEAIAELDTL 214          
BLAST of CN188435 vs. ExPASy Swiss-Prot
Match: 14333_ORYSJ (14-3-3-like protein GF14-C OS=Oryza sativa subsp. japonica GN=GF14C PE=1 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 7.209e-89
Identity = 163/210 (77.62%), Postives = 188/210 (89.52%), Query Frame = 1
Query:   46 TREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAFEEAIAELDTL 675
            +RE+ VY+AKLAEQAERYEEMV++M+  V  +    ELTVEERNLLSVAYKNVIG+ RA+WRI+SSIEQKEEGR NEEHV+L+K+YR K+E+ELS +C  ILKLLDSHLVPS+TA ESKVFYLKMKGDY+RYLAEFK G ERK AAE+TM++YKAAQDIAL DLAPTHPIRLGLALNFSVFYYEILNS +KAC +AKQAF+EAI+ELDTL
Sbjct:    2 SREENVYMAKLAEQAERYEEMVEYMEK-VAKTVDVEELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEEGRGNEEHVTLIKEYRGKIEAELSKICDGILKLLDSHLVPSSTAAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTMVAYKAAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDKACNLAKQAFDEAISELDTL 210          
BLAST of CN188435 vs. ExPASy Swiss-Prot
Match: 14332_MAIZE (14-3-3-like protein GF14-12 OS=Zea mays GN=GRF2 PE=2 SV=2)

HSP 1 Score: 323.553 bits (828), Expect = 6.103e-88
Identity = 162/210 (77.14%), Postives = 189/210 (90.00%), Query Frame = 1
Query:   46 TREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAFEEAIAELDTL 675
            +RE+ VY+AKLAEQAERYEEMV+FM+  V  +  + ELTVEERNLLSVAYKNVIG+ RA+WRIISSIEQKEEGR NE+ V+L+KDYR K+E+EL+ +C  ILKLL+SHLVPS+TA ESKVFYLKMKGDYYRYLAEFK G ERK AAENTM++YKAAQDIAL +LAPTHPIRLGLALNFSVFYYEILNS ++AC++AKQAF+EAI+ELDTL
Sbjct:    7 SREENVYMAKLAEQAERYEEMVEFMEK-VAKTVDSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEEGRGNEDRVTLIKDYRGKIETELTKICDGILKLLESHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTL 215          
BLAST of CN188435 vs. ExPASy Swiss-Prot
Match: 1433_LILLO (14-3-3-like protein OS=Lilium longiflorum PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 7.971e-88
Identity = 162/211 (76.78%), Postives = 188/211 (89.10%), Query Frame = 1
Query:   43 PTREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAFEEAIAELDTL 675
            P+RE+ VY+AKLAEQAERYEEMV+FM+  V  +    ELTVEERNLLSVAYKNVIG+ RA+WRIISSIEQKEE R NE+HV+L+KDYR K+E+ELS +C  ILKLLDSHLVPS+TA ESKVFYLKMKGDY+RYLAEFK G ERK AAE+T+L+YK+AQDIAL +LAPTHPIRLGLALNFSVFYYEILNS ++AC +AKQAF+EAI+ELDTL
Sbjct:    6 PSREENVYMAKLAEQAERYEEMVEFMEK-VARTVDTEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDHVALIKDYRGKIEAELSKICDGILKLLDSHLVPSSTAPESKVFYLKMKGDYHRYLAEFKSGAERKEAAESTLLAYKSAQDIALAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTL 215          
BLAST of CN188435 vs. ExPASy Swiss-Prot
Match: 1433_HELAN (14-3-3-like protein OS=Helianthus annuus PE=2 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 1.360e-87
Identity = 161/215 (74.88%), Postives = 186/215 (86.51%), Query Frame = 1
Query:   31 AMGTPTREQYVYLAKLAEQAERYEEMVKFMDSLVTSSTPATELTVEERNLLSVAYKNVIGSLRAAWRIISSIEQKEEGRKNEEHVSLVKDYRSKVESELSDVCGSILKLLDSHLVPSATAGESKVFYLKMKGDYYRYLAEFKVGDERKAAAENTMLSYKAAQDIALTDLAPTHPIRLGLALNFSVFYYEILNSSEKACTMAKQAFEEAIAELDTL 675
            A  +  RE+ VYLAKLAEQAERYEEMV+FM+ +V ++    ELT+EERNLLSVAYKNVIG+ RA+WRIISSIEQKEE R NE HVS ++DYRSK+ESELS +C  ILK+LDS L+ SA+ G+SKVFYLKMKGDYYRYLAEFK GDERK AAENT+ +YKAAQDIA  +LAPTHPIRLGLALNFSVFYYEILNS ++AC +AKQAF+EAIAELDTL
Sbjct:    2 AAASSPREENVYLAKLAEQAERYEEMVEFMEKVVAAADGGEELTIEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEGHVSTIRDYRSKIESELSSICDGILKVLDSKLIGSASGGDSKVFYLKMKGDYYRYLAEFKTGDERKLAAENTLSAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTL 216          
The following BLAST results are available for this feature:
BLAST of CN188435 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 142
Match NameE-valueIdentityDescription
14338_ARATH5.322e-10085.3814-3-3-like protein GF14 kappa OS=Arabidopsis thal... [more]
14336_ARATH4.505e-9986.6014-3-3-like protein GF14 lambda OS=Arabidopsis tha... [more]
1433D_TOBAC8.496e-9887.1414-3-3-like protein D OS=Nicotiana tabacum PE=2 SV... [more]
14331_SOLLC2.472e-9786.1914-3-3 protein 1 OS=Solanum lycopersicum GN=TFT1 P... [more]
14310_SOLLC5.507e-9785.7114-3-3 protein 10 OS=Solanum lycopersicum GN=TFT10... [more]
1433B_SOYBN1.039e-9584.2114-3-3-like protein B (Fragment) OS=Glycine max GN... [more]
14333_ORYSJ7.209e-8977.6214-3-3-like protein GF14-C OS=Oryza sativa subsp. ... [more]
14332_MAIZE6.103e-8877.1414-3-3-like protein GF14-12 OS=Zea mays GN=GRF2 PE... [more]
1433_LILLO7.971e-8876.7814-3-3-like protein OS=Lilium longiflorum PE=2 SV=... [more]
1433_HELAN1.360e-8774.8814-3-3-like protein OS=Helianthus annuus PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006A14_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006A14, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188435 ID=CN188435; Name=CN188435; organism=Citrus sinensis; type=EST; length=676bp
AGTAGTTAACTTTACAGTTTCTGCAATTCTGCTATGGGAACCCCGACGAG
AGAGCAATACGTTTACCTGGCGAAACTCGCCGAGCAAGCCGAGCGCTATG
AAGAGATGGTTAAGTTCATGGACAGCCTCGTCACTTCCTCCACTCCGGCG
ACTGAACTCACCGTCGAGGAGCGCAACCTCCTCTCCGTTGCTTACAAGAA
CGTCATCGGCTCTCTTCGCGCCGCGTGGCGTATTATCTCCTCGATCGAGC
AGAAAGAGGAAGGCCGCAAGAACGAGGAACACGTCTCGCTGGTCAAAGAC
TATCGGTCAAAGGTAGAGTCTGAGTTATCTGACGTGTGCGGGAGCATATT
GAAGTTGCTGGACTCGCACCTTGTGCCTTCGGCTACTGCTGGTGAGTCCA
AAGTCTTCTATTTGAAGATGAAGGGAGATTATTACCGTTACTTGGCGGAG
TTTAAAGTTGGTGATGAGAGGAAGGCCGCCGCTGAAAACACTATGTTGTC
TTATAAGGCGGCTCAGGATATTGCACTGACTGATCTGGCGCCAACACACC
CTATAAGGTTGGGGCTGGCACTCAACTTCTCAGTGTTTTACTATGAGATT
CTCAATTCATCAGAGAAAGCTTGTACCATGGCCAAACAGGCCTTTGAGGA
GGCCATTGCTGAGCTGGACACTTTGG
back to top