CN188427

Overview
NameCN188427
Unique NameCN188427
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length678
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN188427 vs. ExPASy Swiss-Prot
Match: PSL4_MOUSE (Signal peptide peptidase-like 3 OS=Mus musculus GN=Sppl3 PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.451e-12
Identity = 43/159 (27.04%), Postives = 81/159 (50.94%), Query Frame = 2
Query:  236 TLILTAVAVTFGSAFRALNY---GKEMERNRDLSEASI----------MLDRSQALMIPVMSSCSLVLMFYLFSSVSQLLTALTAVASVSSLFFCLSPYIAHVRSQFGLADPFVSRCCSKSLTRIQWLLLLACTSVVVAWLVSGHWILNNLLGIAICIA 673
            T +++ + + +GS FR+LN     ++ E++ + S  S            +D +QAL +P+ +S SL++MF+ F SV  + T  TAV +  +  F L P   ++       +     CC +  T  + L       +V+ W+++GHW+L + L + +C+A
Sbjct:   20 TFLISILLIVYGS-FRSLNMDFENQDKEKDSNSSSGSFNGNSTNNSIQTIDSTQALFLPIGASVSLLVMFFFFDSVQVVFTICTAVLATIAFAFLLLPMCQYLTRPCSPQNKISFGCCGR-FTAAELLSFSLSVMLVLIWVLTGHWLLMDALAMGLCVA 176          
The following BLAST results are available for this feature:
BLAST of CN188427 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PSL4_MOUSE2.451e-1227.04Signal peptide peptidase-like 3 OS=Mus musculus GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006A08_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188427 ID=CN188427; Name=CN188427; organism=Citrus sinensis; type=EST; length=678bp
GCAGTAAAGAAACCTCGTTAATGACTGACGAGCAAGACATCTCCCAACTT
GCAAACTCTTCAGAGTCCAAGGTTGCATCCCTTCATTGGTCAAGTGTTCA
TCAGAGTAGGACTGCAACTTTGGCTGCAGAGTTTGTAACTATTATGCTTT
ATCTCTTCATCTAGCTCAGGAGAATTTTGCTTACTTAATGGAGCCTTTAT
GGAAACTTTTATATCTGCTGGAGCCTGCACCTGTTACTCTTATTCTGACG
GCAGTGGCTGTCACATTTGGATCTGCATTTCGAGCTTTAAATTATGGAAA
AGAAATGGAGAGAAACCGTGACTTATCAGAAGCATCCATTATGTTAGATA
GGTCCCAAGCACTAATGATCCCAGTAATGAGCTCCTGTAGCTTGGTTTTG
ATGTTCTATCTGTTTTCTTCAGTCTCACAACTCCTCACCGCCTTAACAGC
TGTTGCCTCTGTTTCATCCCTTTTCTTTTGCCTATCTCCCTATATTGCCC
ATGTAAGGTCGCAGTTTGGTTTGGCTGACCCATTTGTGTCACGATGCTGT
TCAAAGTCCTTGACACGAATCCAATGGTTATTATTGTTGGCTTGCACTTC
TGTGGTTGTGGCTTGGCTGGTTTCTGGGCATTGGATATTAAACAACTTGT
TGGGAATTGCAATCTGTATTGCATTTGT
back to top