CN188426

Overview
NameCN188426
Unique NameCN188426
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length779
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN188426 vs. ExPASy Swiss-Prot
Match: PSL4_MOUSE (Signal peptide peptidase-like 3 OS=Mus musculus GN=Sppl3 PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 3.691e-13
Identity = 57/183 (31.15%), Postives = 85/183 (46.45%), Query Frame = -3
Query:  253 FGANVMVSVATQQASNPVHTVANSLSL-PGLQLITKKLELPVKIVFPRNLFGGVTPGGNATDFXXXXXXXXXXXXXXXXLVLCFDHRK---SSNTVSLFDLHSSKGH----KYIWYALPGYAIGLVTALSAGVLTHSPQPALLYLVPSTLGPVIVMSWVRKDLDELWEGTLSNINDKSHQIEV 777
            F +NVMV VATQ A NP+  ++  L L P +     +L LP K+VFP +           + F                 VL +D+ K   S ++       +  G      Y    L GY +GL+TA  A  +  + QPALLYLVP TL P++ M++++ DL  +W     + +  S  +EV
Sbjct:  211 FNSNVMVKVATQPADNPLDVLSKKLHLGPNVGRDVPRLSLPGKLVFPSS---------TGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQASGDSCGAPGPANISGRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWSEPFHSKSSSSRFLEV 384          
BLAST of CN188426 vs. ExPASy Swiss-Prot
Match: PSL4_HUMAN (Signal peptide peptidase-like 3 OS=Homo sapiens GN=SPPL3 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.691e-13
Identity = 57/183 (31.15%), Postives = 85/183 (46.45%), Query Frame = -3
Query:  253 FGANVMVSVATQQASNPVHTVANSLSL-PGLQLITKKLELPVKIVFPRNLFGGVTPGGNATDFXXXXXXXXXXXXXXXXLVLCFDHRK---SSNTVSLFDLHSSKGH----KYIWYALPGYAIGLVTALSAGVLTHSPQPALLYLVPSTLGPVIVMSWVRKDLDELWEGTLSNINDKSHQIEV 777
            F +NVMV VATQ A NP+  ++  L L P +     +L LP K+VFP +           + F                 VL +D+ K   S ++       +  G      Y    L GY +GL+TA  A  +  + QPALLYLVP TL P++ M++++ DL  +W     + +  S  +EV
Sbjct:  212 FNSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSS---------TGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQASGDSCGAPGPANISGRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWSEPFHSKSSSSRFLEV 385          
The following BLAST results are available for this feature:
BLAST of CN188426 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PSL4_MOUSE3.691e-1331.15Signal peptide peptidase-like 3 OS=Mus musculus GN... [more]
PSL4_HUMAN3.691e-1331.15Signal peptide peptidase-like 3 OS=Homo sapiens GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006A08_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188426 ID=CN188426; Name=CN188426; organism=Citrus sinensis; type=EST; length=779bp
TTTTTTTTTTTTTTTTTGAAGAAAGATCTGTCTTCCCTATTAGAAGAATT
ACACAGCATAAAAATTCAGATAAATTTTAATTCTTCTTCATTATCAGCCA
ATCTGAAGGAAGGTTCCACGGGTTAAATATTGAAGAATTTTCAATGTCCT
CCCCAGGTTTTCAAGGGCAGAATTTTCCCATTCAAATTTACAACTTTCAA
TTGGCTCTAAAAGTTTTACTGTGGCAATGAACCACATAAATAAAATTGTT
TAGACTTCTATTTGATGAGATTTATCATTGATATTTGACAAGGTTCCTTC
CCATAACTCGTCTAGGTCCTTCCTCACCCACGACATAACAATTACGGGTC
CCAAAGTAGAAGGCACCAAATAAAGAAGGGCAGGTTGAGGTGAGTGAGTC
AAAACTCCGGCAGATAAAGCAGTTACGAGTCCAATGGCATATCCTGGAAG
GGCATACCATATGTATTTGTGCCCTTTTGAAGAATGTAAATCAAAAAGAC
TAACTGTATTGCTGCTCTTTCGATGATCGAAGCAGAGGACCAATGCTAAA
AGCATGGCAGGCATTGCCATGTCACCAAGACCAAGCATCATGAAGTCTGT
GGCATTTCCTCCAGGAGTCACTCCACCAAACAAGTTCCTGGGAAATACAA
TTTTGACTGGCAATTCCAGCTTCTTCGTTATTAGTTGCAACCCTGGAAGG
CTCAAACTATTAGCCACTGTGTGAACGGGATTTGATGCCTGTTGTGTTGC
TACTGATACCATGACATTTGCCCCAAAAA
back to top