CK938587

Overview
NameCK938587
Unique NameCK938587
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length879
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1550 contig Csv1_Contig1550:132..1010. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK938587 vs. ExPASy Swiss-Prot
Match: DCE_SOLLC (Glutamate decarboxylase OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 493.041 bits (1268), Expect = 9.076e-139
Identity = 235/286 (82.17%), Postives = 259/286 (90.56%), Query Frame = 1
Query:   22 MVISTXXTDSREILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVG 879
            ++ +T   DS E L+ TFASRYV+  +P+FKMP  SMPKEAAYQ++NDELMLDGNPRLNLASFV+TWMEPECDKL+M+SINKNYVDMDEYPVTTELQNRCVNM+AHLF+ PV DD+TAVGVGTVGSSEAIMLAGLAFKRKWQ KRK +GKP+DKPNIVTGANVQVCWEKFARYF           GYYVM+P KAVE+VDENTICVAAILGSTLTGEFEDVKLL++LLTKKN+ETGW+TPIHVDAASGGFIAPFL+PDLEWDFRLPLVKSINVSGHKYGLVYAGVG
Sbjct:    2 VLTTTSIRDSEESLHCTFASRYVQEPLPKFKMPKKSMPKEAAYQIVNDELMLDGNPRLNLASFVSTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMLAHLFHAPVGDDETAVGVGTVGSSEAIMLAGLAFKRKWQSKRKAEGKPFDKPNIVTGANVQVCWEKFARYFEVELKEVKLKEGYYVMDPAKAVEIVDENTICVAAILGSTLTGEFEDVKLLNELLTKKNKETGWETPIHVDAASGGFIAPFLWPDLEWDFRLPLVKSINVSGHKYGLVYAGVG 287          
BLAST of CK938587 vs. ExPASy Swiss-Prot
Match: DCE1_ARATH (Glutamate decarboxylase 1 OS=Arabidopsis thaliana GN=GAD1 PE=1 SV=2)

HSP 1 Score: 488.804 bits (1257), Expect = 1.712e-137
Identity = 234/286 (81.82%), Postives = 259/286 (90.56%), Query Frame = 1
Query:   22 MVISTXXTDSREILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVG 879
            MV+S   ++S   ++STFASRYVR ++PRFKMP+NS+PKEAAYQ+INDELMLDGNPRLNLASFVTTWMEPECDKL+M+SINKNYVDMDEYPVTTELQNRCVNMIAHLFN P+ + +TAVGVGTVGSSEAIMLAGLAFKRKWQ KRK +GKP DKPNIVTGANVQVCWEKFARYF           GYYVM+P +AV++VDENTICVAAILGSTL GEFEDVKLL+DLL +KN+ETGWDTPIHVDAASGGFIAPFLYP+LEWDFRLPLVKSINVSGHKYGLVYAG+G
Sbjct:    1 MVLSHAVSESDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVGVGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPVDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIG 286          
BLAST of CK938587 vs. ExPASy Swiss-Prot
Match: DCE_PETHY (Glutamate decarboxylase OS=Petunia hybrida GN=GAD PE=1 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 2.236e-137
Identity = 236/286 (82.52%), Postives = 255/286 (89.16%), Query Frame = 1
Query:   22 MVISTXXTDSREILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVG 879
            MV+S   + S   ++STFASRYVR ++PRFKMPDNS+PKEAAYQ+INDELMLDGNPRLNLASFVTTWMEPECDKL+M SINKNYVDMDEYPVTTELQNRCVNMIAHLFN P+ D +TAVGVGTVGSSEAIMLAGLAFKRKWQ K K QGKP DKPNIVTGANVQVCWEKFARYF           GYYVM+P KAVE+VDENTICVAAILGSTL GEFEDVK L+DLL +KN+ETGWDTPIHVDAASGGFIAPF+YP+LEWDFRLPLVKSINVSGHKYGLVYAG+G
Sbjct:    1 MVLSKTVSQSDVSIHSTFASRYVRTSLPRFKMPDNSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEDGETAVGVGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPCDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNKETGWDTPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIG 286          
BLAST of CK938587 vs. ExPASy Swiss-Prot
Match: DCE2_ARATH (Glutamate decarboxylase 2 OS=Arabidopsis thaliana GN=GAD2 PE=1 SV=1)

HSP 1 Score: 464.537 bits (1194), Expect = 3.457e-130
Identity = 222/286 (77.62%), Postives = 249/286 (87.06%), Query Frame = 1
Query:   22 MVISTXXTDSREILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVG 879
            MV++   T+   +  + F SRYVR  +P++++ +NS+PK+AAYQ+I DELMLDGNPRLNLASFVTTWMEPECDKL+M SINKNYVDMDEYPVTTELQNRCVN+IA LFN P+ + +TAVGVGTVGSSEAIMLAGLAFKRKWQ KRK +GKPYDKPNIVTGANVQVCWEKFARYF           GYYVM+P KA E+VDENTICVAAILGSTL GEFEDVK L+DLL KKNEETGW+TPIHVDAASGGFIAPF+YP+LEWDFRLPLVKSINVSGHKYGLVYAG+G
Sbjct:    1 MVLTKTATNDESVC-TMFGSRYVRTTLPKYEIGENSIPKDAAYQIIKDELMLDGNPRLNLASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNIIARLFNAPLEESETAVGVGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVNLSEGYYVMDPDKAAEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVKKNEETGWNTPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIG 285          
BLAST of CK938587 vs. ExPASy Swiss-Prot
Match: DCEB_SHIFL (Glutamate decarboxylase beta OS=Shigella flexneri GN=gadB PE=2 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 8.956e-70
Identity = 133/280 (47.50%), Postives = 178/280 (63.57%), Query Frame = 1
Query:   43 TDSR-EILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVG 879
            TD R E+L+S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LHD L K   +TG D  +H+DAASGGF+APF+ PD+ WDFRLP VKSI+ SGHK+GL   G G
Sbjct:    7 TDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCG 285          
BLAST of CK938587 vs. ExPASy Swiss-Prot
Match: DCEB_ECOLI (Glutamate decarboxylase beta OS=Escherichia coli (strain K12) GN=gadB PE=1 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 8.956e-70
Identity = 133/280 (47.50%), Postives = 178/280 (63.57%), Query Frame = 1
Query:   43 TDSR-EILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVG 879
            TD R E+L+S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LHD L K   +TG D  +H+DAASGGF+APF+ PD+ WDFRLP VKSI+ SGHK+GL   G G
Sbjct:    7 TDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCG 285          
BLAST of CK938587 vs. ExPASy Swiss-Prot
Match: DCEB_ECO57 (Glutamate decarboxylase beta OS=Escherichia coli O157:H7 GN=gadB PE=2 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 8.956e-70
Identity = 133/280 (47.50%), Postives = 178/280 (63.57%), Query Frame = 1
Query:   43 TDSR-EILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVG 879
            TD R E+L+S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LHD L K   +TG D  +H+DAASGGF+APF+ PD+ WDFRLP VKSI+ SGHK+GL   G G
Sbjct:    7 TDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCG 285          
BLAST of CK938587 vs. ExPASy Swiss-Prot
Match: DCEA_SHIFL (Glutamate decarboxylase alpha OS=Shigella flexneri GN=gadA PE=2 SV=2)

HSP 1 Score: 263.848 bits (673), Expect = 8.956e-70
Identity = 133/280 (47.50%), Postives = 178/280 (63.57%), Query Frame = 1
Query:   43 TDSR-EILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVG 879
            TD R E+L+S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LHD L K   +TG D  +H+DAASGGF+APF+ PD+ WDFRLP VKSI+ SGHK+GL   G G
Sbjct:    7 TDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCG 285          
BLAST of CK938587 vs. ExPASy Swiss-Prot
Match: DCEA_ECOLI (Glutamate decarboxylase alpha OS=Escherichia coli (strain K12) GN=gadA PE=1 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 8.956e-70
Identity = 133/280 (47.50%), Postives = 178/280 (63.57%), Query Frame = 1
Query:   43 TDSR-EILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVG 879
            TD R E+L+S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LHD L K   +TG D  +H+DAASGGF+APF+ PD+ WDFRLP VKSI+ SGHK+GL   G G
Sbjct:    7 TDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCG 285          
BLAST of CK938587 vs. ExPASy Swiss-Prot
Match: DCEA_ECOL6 (Glutamate decarboxylase alpha OS=Escherichia coli O6 GN=gadA PE=1 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 8.956e-70
Identity = 133/280 (47.50%), Postives = 178/280 (63.57%), Query Frame = 1
Query:   43 TDSR-EILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVG 879
            TD R E+L+S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LHD L K   +TG D  +H+DAASGGF+APF+ PD+ WDFRLP VKSI+ SGHK+GL   G G
Sbjct:    7 TDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCG 285          
The following BLAST results are available for this feature:
BLAST of CK938587 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
DCE_SOLLC9.076e-13982.17Glutamate decarboxylase OS=Solanum lycopersicum PE... [more]
DCE1_ARATH1.712e-13781.82Glutamate decarboxylase 1 OS=Arabidopsis thaliana ... [more]
DCE_PETHY2.236e-13782.52Glutamate decarboxylase OS=Petunia hybrida GN=GAD ... [more]
DCE2_ARATH3.457e-13077.62Glutamate decarboxylase 2 OS=Arabidopsis thaliana ... [more]
DCEB_SHIFL8.956e-7047.50Glutamate decarboxylase beta OS=Shigella flexneri ... [more]
DCEB_ECOLI8.956e-7047.50Glutamate decarboxylase beta OS=Escherichia coli (... [more]
DCEB_ECO578.956e-7047.50Glutamate decarboxylase beta OS=Escherichia coli O... [more]
DCEA_SHIFL8.956e-7047.50Glutamate decarboxylase alpha OS=Shigella flexneri... [more]
DCEA_ECOLI8.956e-7047.50Glutamate decarboxylase alpha OS=Escherichia coli ... [more]
DCEA_ECOL68.956e-7047.50Glutamate decarboxylase alpha OS=Escherichia coli ... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit albedo at 165 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004440_H11 Developing fruit albedo at 165 DAFB Citrus sinensis cDNA clone A1650001_IF_H11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK938587 ID=CK938587|Name=CK938587|organism=Citrus sinensis|type=EST|length=879bp
GGGGAAAAAACAAAAACAAAAATGGTGATTTCAACAANNNNAACAGACTC
CAGGGAGATTTTGAACTCCACATTTGCTTCAAGATATGTCCGTGCTGCTA
TTCCCAGATTCAAGATGCCAGATAATTCAATGCCAAAGGAGGCAGCCTAT
CAGGTAATAAATGATGAGCTGATGTTAGATGGAAATCCAAGGCTGAACTT
GGCATCTTTTGTGACCACTTGGATGGAGCCCGAGTGTGATAAGCTTGTCA
TGGCTTCGATTAATAAAAACTATGTTGACATGGATGAATACCCTGTAACC
ACAGAGCTCCAGAATCGGTGTGTGAATATGATTGCCCACCTATTTAATAC
TCCAGTTGCGGATGACAAGACTGCAGTGGGCGTGGGGACTGTAGGTTCAT
CAGAGGCAATAATGCTTGCTGGCTTGGCTTTTAAAAGGAAGTGGCAGCAG
AAGAGAAAAGAGCAAGGCAAACCCTATGATAAGCCCAATATAGTCACTGG
AGCTAATGTGCAGGTATGCTGGGAGAAATTTGCGAGGTACTTTGAGGTTG
AGCTGAAGGAGGTGAAACTGGAAGAGGGATATTATGTGATGAATCCTGTG
AAAGCTGTTGAGTTGGTAGATGAGAACACCATTTGTGTTGCAGCCATTCT
GGGATCAACCTTGACGGGAGAATTTGAGGATGTTAAGCTTCTTCATGACC
TCCTCACCAAAAAGAATGAGGAGACCGGTTGGGACACCCCCATTCATGTT
GATGCTGCTAGCGGCGGATTTATTGCTCCTTTTCTCTATCCAGACCTTGA
ATGGGATTTCCGTTTGCCACTGGTGAAGAGCATTAATGTCAGTGGTCACA
AGTACGGCCTTGTATATGCAGGTGTTGGC
back to top