CX043405

Overview
NameCX043405
Unique NameCX043405
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length771
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX043405_ssr96 microsatellite CX043405_ssr96:96..109. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CX043405 vs. ExPASy Swiss-Prot
Match: DUSA_SHIFL (tRNA-dihydrouridine synthase A OS=Shigella flexneri GN=dusA PE=3 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 5.781e-43
Identity = 96/199 (48.24%), Postives = 125/199 (62.81%), Query Frame = -2
Query:  195 EMLAAETIIYQQGNL-------HPIVLQIGGSNLDNLAKATELANAYNYDEINLNCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQ 770
            EM+    II+ +G+        HP+ LQ+GGS+   LA+  +LA A  YDEINLN GCPS +V  +G FG  LM + + V + +  +    ++PV+VK RIG+DD DSY  LCDFI  VS       FIIH+RKA L+G+SP ENR IPPL Y   Y L RDFP LT ++NGGI +++E  A L+     VMVGR AYQ
Sbjct:   42 EMVTTGAIIHGKGDYLAYSEEEHPVALQLGGSDPAALAQCAKLAEARGYDEINLNVGCPSDRVQ-NGMFGACLMGNAQLVADCVKAMRDVVSIPVTVKTRIGIDDQDSYEFLCDFINTVSGKGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSLEEAKAHLQH-MDGVMVGREAYQ 238          
BLAST of CX043405 vs. ExPASy Swiss-Prot
Match: DUSA_ECOLI (tRNA-dihydrouridine synthase A OS=Escherichia coli (strain K12) GN=dusA PE=3 SV=3)

HSP 1 Score: 174.481 bits (441), Expect = 5.781e-43
Identity = 96/199 (48.24%), Postives = 125/199 (62.81%), Query Frame = -2
Query:  195 EMLAAETIIYQQGNL-------HPIVLQIGGSNLDNLAKATELANAYNYDEINLNCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQ 770
            EM+    II+ +G+        HP+ LQ+GGS+   LA+  +LA A  YDEINLN GCPS +V  +G FG  LM + + V + +  +    ++PV+VK RIG+DD DSY  LCDFI  VS       FIIH+RKA L+G+SP ENR IPPL Y   Y L RDFP LT ++NGGI +++E  A L+     VMVGR AYQ
Sbjct:   42 EMVTTGAIIHGKGDYLAYSEEEHPVALQLGGSDPAALAQCAKLAEARGYDEINLNVGCPSDRVQ-NGMFGACLMGNAQLVADCVKAMRDVVSIPVTVKTRIGIDDQDSYEFLCDFINTVSGKGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSLEEAKAHLQH-MDGVMVGREAYQ 238          
BLAST of CX043405 vs. ExPASy Swiss-Prot
Match: DUSA_ECOL6 (tRNA-dihydrouridine synthase A OS=Escherichia coli O6 GN=dusA PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 5.781e-43
Identity = 96/199 (48.24%), Postives = 125/199 (62.81%), Query Frame = -2
Query:  195 EMLAAETIIYQQGNL-------HPIVLQIGGSNLDNLAKATELANAYNYDEINLNCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQ 770
            EM+    II+ +G+        HP+ LQ+GGS+   LA+  +LA A  YDEINLN GCPS +V  +G FG  LM + + V + +  +    ++PV+VK RIG+DD DSY  LCDFI  VS       FIIH+RKA L+G+SP ENR IPPL Y   Y L RDFP LT ++NGGI +++E  A L+     VMVGR AYQ
Sbjct:   43 EMVTTGAIIHGKGDYLAYSEEEHPVALQLGGSDPAALAQCAKLAEARGYDEINLNVGCPSDRVQ-NGMFGACLMGNAQLVADCVKAMRDVVSIPVTVKTRIGIDDQDSYEFLCDFINTVSGKGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSLEEAKAHLQH-MDGVMVGREAYQ 239          
BLAST of CX043405 vs. ExPASy Swiss-Prot
Match: DUSA_ECO57 (tRNA-dihydrouridine synthase A OS=Escherichia coli O157:H7 GN=dusA PE=3 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 5.781e-43
Identity = 96/199 (48.24%), Postives = 125/199 (62.81%), Query Frame = -2
Query:  195 EMLAAETIIYQQGNL-------HPIVLQIGGSNLDNLAKATELANAYNYDEINLNCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQ 770
            EM+    II+ +G+        HP+ LQ+GGS+   LA+  +LA A  YDEINLN GCPS +V  +G FG  LM + + V + +  +    ++PV+VK RIG+DD DSY  LCDFI  VS       FIIH+RKA L+G+SP ENR IPPL Y   Y L RDFP LT ++NGGI +++E  A L+     VMVGR AYQ
Sbjct:   42 EMVTTGAIIHGKGDYLAYSEEEHPVALQLGGSDPAALAQCAKLAEARGYDEINLNVGCPSDRVQ-NGMFGACLMGNAQLVADCVKAMRDVVSIPVTVKTRIGIDDQDSYEFLCDFINTVSGKGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSLEEAKAHLQH-MDGVMVGREAYQ 238          
BLAST of CX043405 vs. ExPASy Swiss-Prot
Match: DUSA_SALTI (tRNA-dihydrouridine synthase A OS=Salmonella typhi GN=dusA PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.288e-42
Identity = 96/199 (48.24%), Postives = 123/199 (61.81%), Query Frame = -2
Query:  195 EMLAAETIIYQQGNL-------HPIVLQIGGSNLDNLAKATELANAYNYDEINLNCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQ 770
            EM+    II+ +G+        HP+ LQ+GGS+   LA   +LA A  YDEINLN GCPS +V  +G FG  LM + + V + +  +    ++PV+VK RIG+DD DSY  LCDFI  VS       FIIH+RKA L+G+SP ENR IPPL Y   Y L RDFP LT ++NGGI +++E    LR     VMVGR AYQ
Sbjct:   44 EMVTTGAIIHGKGDYLAYSEEEHPVALQLGGSDPAQLAHCAKLAEARGYDEINLNVGCPSDRVQ-NGMFGACLMGNAQLVADCVKAMRDVVSIPVTVKTRIGIDDQDSYAFLCDFINTVSGQGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSLEEAKEHLRH-MDGVMVGREAYQ 240          
BLAST of CX043405 vs. ExPASy Swiss-Prot
Match: DUSA_SALTY (tRNA-dihydrouridine synthase A OS=Salmonella typhimurium GN=dusA PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.682e-42
Identity = 96/199 (48.24%), Postives = 123/199 (61.81%), Query Frame = -2
Query:  195 EMLAAETIIYQQGNL-------HPIVLQIGGSNLDNLAKATELANAYNYDEINLNCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQ 770
            EM+    II+ +G+        HP+ LQ+GGS+   LA   +LA A  YDEINLN GCPS +V  +G FG  LM + + V + +  +    ++PV+VK RIG+DD DSY  LCDFI  VS       FIIH+RKA L+G+SP ENR IPPL Y   Y L RDFP LT ++NGGI +++E    LR     VMVGR AYQ
Sbjct:   44 EMVTTGAIIHGKGDYLAYSEEEHPVALQLGGSDPAQLAHCAKLAEARGYDEINLNVGCPSDRVQ-NGMFGACLMGNAQLVADCVKAMRDVVSIPVTVKTRIGIDDQDSYAFLCDFIDTVSGQGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSLEEAKEHLRH-MDGVMVGREAYQ 240          
BLAST of CX043405 vs. ExPASy Swiss-Prot
Match: DUSA_VIBPA (tRNA-dihydrouridine synthase A OS=Vibrio parahaemolyticus GN=dusA PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.860e-41
Identity = 91/199 (45.73%), Postives = 123/199 (61.81%), Query Frame = -2
Query:  195 EMLAAETIIYQQGNL-------HPIVLQIGGSNLDNLAKATELANAYNYDEINLNCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQ 770
            EM+    II+ +G+        HP+ LQ+GGSN ++LAK  +LA    YDEINLN GCPS +V  +G FG  LM +P+ V + ++ +    +VPV+VK RIG+DD DSY  L DF+  VS       F IH+RKA L+G+SP ENR IPPL Y   Y L +DF  LT  +NGG+ +++E    L+     VM+GR AYQ
Sbjct:   36 EMVTTGAIIHGKGDFLAYNEEEHPLALQLGGSNPEDLAKCAKLAQERGYDEINLNVGCPSDRVQ-NGRFGACLMAEPQLVADCVAAMKEVVDVPVTVKTRIGIDDQDSYEFLTDFVSIVSEKGGCEQFTIHARKAWLSGLSPKENREIPPLDYPRAYQLKQDFSHLTIAINGGVKSLEEAKVHLQH-LDGVMIGREAYQ 232          
BLAST of CX043405 vs. ExPASy Swiss-Prot
Match: DUSA_VIBCH (tRNA-dihydrouridine synthase A OS=Vibrio cholerae GN=dusA PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 9.230e-41
Identity = 91/199 (45.73%), Postives = 120/199 (60.30%), Query Frame = -2
Query:  195 EMLAAETIIYQQGNL-------HPIVLQIGGSNLDNLAKATELANAYNYDEINLNCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQ 770
            EM+    II+ +G+        HP+ LQ GGSN  +LA   +LA    YDEINLN GCPS +V  +G FG  LM +P  V E ++ + A  ++PV+VK RIG+DD DSY  L  FI  V+       F IH+RKA L+G+SP ENR IPPL Y   Y + RDFP LT  +NGG+ +++E    L+     VM+GR AYQ
Sbjct:   36 EMVTTGAIIHGRGDFLAYNQEEHPVALQFGGSNPKDLAHCAKLAQERGYDEINLNVGCPSDRVQ-NGRFGACLMGEPDLVAECVAAMRAVVDIPVTVKTRIGIDDQDSYEFLTQFIATVAEKGGCEQFTIHARKAWLSGLSPKENREIPPLDYPRAYQIKRDFPHLTIAVNGGVKSLEEAKLHLQH-LDGVMIGREAYQ 232          
BLAST of CX043405 vs. ExPASy Swiss-Prot
Match: DUSA_HAEDU (tRNA-dihydrouridine synthase A OS=Haemophilus ducreyi GN=dusA PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.574e-40
Identity = 92/199 (46.23%), Postives = 122/199 (61.31%), Query Frame = -2
Query:  195 EMLAAETIIYQQGNL-------HPIVLQIGGSNLDNLAKATELANAYNYDEINLNCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQ 770
            EM+ A  I++ + +L        P+ LQ+GGS+   LA   +L  A  Y EINLN GCPS +V  +G FG  LM +   V + +  +    ++PV++K RIG+D  DSY  LCDFI K+   S  + FI+H+RKA L+G+SP ENR IPPL YE  Y L RDFP L  ++NGGI T+DE+   L K    VMVGR AYQ
Sbjct:   39 EMITAPAILHAKYDLLEYDPAEQPVALQLGGSDPTQLANCAKLVQARGYTEINLNVGCPSDRVQ-NGMFGACLMANADLVADCIKAMQDVVDIPVTIKHRIGIDTLDSYAFLCDFIDKIQPYS--QDFIVHARKAWLSGLSPKENREIPPLDYERVYQLKRDFPQLNISINGGIKTIDEIKQHLTK-VDGVMVGREAYQ 233          
BLAST of CX043405 vs. ExPASy Swiss-Prot
Match: DUSA_VIBVU (tRNA-dihydrouridine synthase A OS=Vibrio vulnificus GN=dusA PE=3 SV=2)

HSP 1 Score: 165.622 bits (418), Expect = 2.685e-40
Identity = 88/199 (44.22%), Postives = 121/199 (60.80%), Query Frame = -2
Query:  195 EMLAAETIIYQQGNL-------HPIVLQIGGSNLDNLAKATELANAYNYDEINLNCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQ 770
            EM+    II+ +G+        HP+ LQ+GGSN  +LA   +LA    YDE+NLN GCPS +V  +G FG  LM +P+ V + ++ +    ++PV+VK RIG+DD DSY  L DF+  VS       F IH+RKA L+G+SP ENR IPPL Y   Y L +DF  LT  +NGG+ +++E    L+     VM+GR AYQ
Sbjct:   36 EMITTGAIIHGKGDFLAYNQEEHPVALQLGGSNPQDLATCAKLAAERGYDEVNLNVGCPSDRVQ-NGRFGACLMAEPQLVADCVAAMKEVVDIPVTVKTRIGIDDQDSYEFLTDFVSIVSEKGGCEQFTIHARKAWLSGLSPKENREIPPLDYPRAYQLKKDFSHLTIAINGGVKSLEEAKEHLQH-LDGVMIGREAYQ 232          
The following BLAST results are available for this feature:
BLAST of CX043405 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
DUSA_SHIFL5.781e-4348.24tRNA-dihydrouridine synthase A OS=Shigella flexner... [more]
DUSA_ECOLI5.781e-4348.24tRNA-dihydrouridine synthase A OS=Escherichia coli... [more]
DUSA_ECOL65.781e-4348.24tRNA-dihydrouridine synthase A OS=Escherichia coli... [more]
DUSA_ECO575.781e-4348.24tRNA-dihydrouridine synthase A OS=Escherichia coli... [more]
DUSA_SALTI1.288e-4248.24tRNA-dihydrouridine synthase A OS=Salmonella typhi... [more]
DUSA_SALTY1.682e-4248.24tRNA-dihydrouridine synthase A OS=Salmonella typhi... [more]
DUSA_VIBPA1.860e-4145.73tRNA-dihydrouridine synthase A OS=Vibrio parahaemo... [more]
DUSA_VIBCH9.230e-4145.73tRNA-dihydrouridine synthase A OS=Vibrio cholerae ... [more]
DUSA_HAEDU1.574e-4046.23tRNA-dihydrouridine synthase A OS=Haemophilus ducr... [more]
DUSA_VIBVU2.685e-4044.22tRNA-dihydrouridine synthase A OS=Vibrio vulnificu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_10H03_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-10H03-P6-1-6.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043405 ID=CX043405; Name=CX043405; organism=Citrus sinensis; type=EST; length=771bp
TTTAAATCTAAAAAAAAATCTCTATTTATTAGATAATAGAGAATATACAA
AGAAATGAAATGGTGATGCCACATCACCTCCTCAAGTCCCAACTTTATAT
ATATATATAGATTAGAGCAAACAGAAAATCATTTAATGAACAAGACCAGT
TCAAAAGTTTTTGCTGATGTCAGAATCATTCATTATACATACTTCTGGTA
TGCAGCACGTCCAACCATAACATGGTGAGCACCTTTCCTTAGCGCAGCAT
TTACCTCATCAACTGTATTAATGCCTCCATTTAGTGTAAATGTCAAGTCT
GGAAAGTCACGCAAGAGGGCATAATAGTACTCATACTTCAAAGGAGGAAT
TGTTCGATTTTCAGCCGGGCTAATGCCATTGAGCAGTGCCTTCCGTGAAT
GTATGATGAAATGCCTAGTTGGGGATAAAGAAGAGACTTTATAGATGAAA
TCACAGAGCTGATTGTATGAATCGTGATCGTCGACACCAATTCGGCATTT
GACGCTAACAGGAACATTTGTGTTAGCAGCAATTACTGACATTGCCTCGC
CAACAAACTTTGGATCAAGCATAAGACTAACACCAAAGCACCCATGTCCA
GCTACTTTAGGACTAGGACATCCACAATTTAAATTGATTTCATCATAGTT
GTATGCATTGGCAAGTTCAGTCGCTTTGGCCAGGTTATCCAAGTTACTAC
CACCAATTTGAAGGACAATAGGATGCAAATTTCCCTGTTGATAAATAATT
GTCTCAGCTGCAAGCATCTCT
back to top