CK937438

Overview
NameCK937438
Unique NameCK937438
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length728
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10142 contig Csv1_Contig10142:8..735. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK937438 vs. ExPASy Swiss-Prot
Match: GL117_ARATH (Germin-like protein subfamily 1 member 17 OS=Arabidopsis thaliana GN=At5g39150 PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 6.743e-75
Identity = 137/199 (68.84%), Postives = 160/199 (80.40%), Query Frame = 2
Query:  128 DPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFIN 724
            DP  LQD CVAI+DPK+GVFVNGKFCKDPK A+AEDFF SGL + G T N++  + T  NV+QIPGLNTLGIS  RIDYAPYGQ PPH HPRA+EI +++EGTLYVGFV+S+Q NN L AKVLN GDVFVFP G+IHFQ NIGKT A A++ L+SQ  G +TIADTVFG+ P INPD L +AFQLD  +VKDL+ KF N
Sbjct:   23 DPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQAKAEDFFSSGLNQAGITNNKVQSNVTTVNVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNVVKDLEAKFKN 221          
BLAST of CK937438 vs. ExPASy Swiss-Prot
Match: GL115_ARATH (Germin-like protein subfamily 1 member 15 OS=Arabidopsis thaliana GN=At5g39120 PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 6.743e-75
Identity = 137/199 (68.84%), Postives = 160/199 (80.40%), Query Frame = 2
Query:  128 DPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFIN 724
            DP  LQD CVAI+DPK+GVFVNGKFCKDPK A+AEDFF SGL + G T N++  + T  NV+QIPGLNTLGIS  RIDYAPYGQ PPH HPRA+EI +++EGTLYVGFV+S+Q NN L AKVLN GDVFVFP G+IHFQ NIGKT A A++ L+SQ  G +TIADTVFG+ P INPD L +AFQLD  +VKDL+ KF N
Sbjct:   23 DPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQAKAEDFFSSGLNQAGITNNKVKSNVTTVNVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNVVKDLEAKFKN 221          
BLAST of CK937438 vs. ExPASy Swiss-Prot
Match: GL114_ARATH (Germin-like protein subfamily 1 member 14 OS=Arabidopsis thaliana GN=At5g39110 PE=2 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 1.502e-74
Identity = 136/199 (68.34%), Postives = 159/199 (79.90%), Query Frame = 2
Query:  128 DPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFIN 724
            DP  LQD CVAI D K+GVFVNGKFCKDPK A+AEDFF+SGL + G T N++  + T  NV+QIPGLNTLGIS  RIDYAPYGQ PPH HPRA+EI +++EGTLYVGFV+S+Q NN L AKVLN GDVFVFP G+IHFQ NIGKT A A++ L+SQ  G +TIADTVFG+ P INPD L +AFQLD  +VKDL+ KF N
Sbjct:   24 DPSPLQDFCVAIGDLKNGVFVNGKFCKDPKQAKAEDFFYSGLNQAGTTNNKVKSNVTTVNVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNVVKDLEAKFKN 222          
BLAST of CK937438 vs. ExPASy Swiss-Prot
Match: GL119_ARATH (Germin-like protein subfamily 1 member 19 OS=Arabidopsis thaliana GN=At5g39180 PE=2 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 3.347e-74
Identity = 136/199 (68.34%), Postives = 159/199 (79.90%), Query Frame = 2
Query:  128 DPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFIN 724
            DP  LQD CVAI+DPK+GVFVNGKFCKDPK A+AEDFF SGL + G T N++  + T  NV+QIPGLNTLGIS  RIDYAPYGQ PPH HPRA+EI +++EGTLYVGFV+S+Q NN L AKVLN GDVFVFP G+IHFQ NIGKT A A++ L+SQ  G +TIAD VFG+ P INPD L +AFQLD  +VKDL+ KF N
Sbjct:   23 DPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQAKAEDFFSSGLNQAGITNNKVQSNVTTVNVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADIVFGSTPPINPDILAQAFQLDVNVVKDLEAKFKN 221          
BLAST of CK937438 vs. ExPASy Swiss-Prot
Match: GL113_ARATH (Germin-like protein subfamily 1 member 13 OS=Arabidopsis thaliana GN=GLP6 PE=2 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 3.347e-74
Identity = 136/199 (68.34%), Postives = 160/199 (80.40%), Query Frame = 2
Query:  128 DPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFIN 724
            DP  LQD CVAI+D K+GVFVNGKFCKDPK A+AEDFFFSGL + G+T N++  + T  NV+QIPGLNT+GIS  RIDYAPYGQ PPH HPRA+EI +++EGTLYVGFV+S+Q NN L AKVL  GDVFVFP G+IHFQ NIGKT A A++ L+SQ  G +TIADTVFG+ P INPD L +AFQLD  IVKDL+ KF N
Sbjct:   24 DPSPLQDFCVAIDDLKNGVFVNGKFCKDPKQAKAEDFFFSGLNQAGSTNNKVRSNVTTVNVDQIPGLNTMGISLVRIDYAPYGQNPPHTHPRATEILVLIEGTLYVGFVSSNQDNNRLFAKVLYPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNIVKDLEAKFRN 222          
BLAST of CK937438 vs. ExPASy Swiss-Prot
Match: GL118_ARATH (Germin-like protein subfamily 1 member 18 OS=Arabidopsis thaliana GN=GLP2A PE=2 SV=2)

HSP 1 Score: 268.085 bits (684), Expect = 3.463e-71
Identity = 134/220 (60.91%), Postives = 163/220 (74.09%), Query Frame = 2
Query:   59 MKVIQFLIGFXXXXXXXXXXXXTDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKF 718
            M+V Q L+ F             DP  LQD CVAI+D K GVFVNG+FCKDPK   A+DFFFSGL  PGNT N++G + T  NV+QIPGLNT+GIS  RIDYAP+GQ PPH HPR SEI +++EGTLYVGFV+S+Q NN L AKVL+ GDVFVFP G+IHFQ N+GK  A A++ L+SQ  G +TIA+TVFG+NP I P+ L +AFQLD  +VK+LQ KF
Sbjct:    1 MRVSQSLVPFAIIALVLSFVNAYDPSPLQDFCVAIDDLK-GVFVNGRFCKDPKRVDAKDFFFSGLNMPGNTNNQVGSNVTTVNVDQIPGLNTMGISLVRIDYAPHGQNPPHTHPRGSEILVLVEGTLYVGFVSSNQDNNRLFAKVLHPGDVFVFPIGMIHFQVNVGKIPAVAFAGLSSQNAGVITIANTVFGSNPPIYPELLARAFQLDASVVKELQAKF 219          
BLAST of CK937438 vs. ExPASy Swiss-Prot
Match: GL120_ARATH (Germin-like protein subfamily 1 member 20 OS=Arabidopsis thaliana GN=GLP5A PE=1 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 4.523e-71
Identity = 134/220 (60.91%), Postives = 163/220 (74.09%), Query Frame = 2
Query:   59 MKVIQFLIGFXXXXXXXXXXXXTDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKF 718
            M+V Q L+ F             DP  LQD CVAI+D K GVFVNG+FCKDPK   A+DFFFSGL  PGNT N++G + T  NV+QIPGLNT+GIS  RIDYAP+GQ PPH HPR SEI +++EGTLYVGFV+S+Q NN L AKVL+ GDVFVFP G+IHFQ N+GK  A A++ L+SQ  G +TIA+TVFG+NP I P+ L +AFQLD  +VK+LQ KF
Sbjct:    1 MRVSQSLVPFAIIALVLSFVNAYDPSPLQDFCVAIDDLK-GVFVNGRFCKDPKRVDAKDFFFSGLNVPGNTNNQVGSNVTTVNVDQIPGLNTMGISLVRIDYAPHGQNPPHTHPRGSEILVLVEGTLYVGFVSSNQDNNRLFAKVLHPGDVFVFPIGMIHFQVNVGKIPAVAFAGLSSQNAGVITIANTVFGSNPPIYPELLARAFQLDASVVKELQAKF 219          
BLAST of CK937438 vs. ExPASy Swiss-Prot
Match: GL116_ARATH (Germin-like protein subfamily 1 member 16 OS=Arabidopsis thaliana GN=At5g39130 PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 7.715e-71
Identity = 135/220 (61.36%), Postives = 163/220 (74.09%), Query Frame = 2
Query:   59 MKVIQFLIGFXXXXXXXXXXXXTDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKF 718
            M+V Q LI F             DP  LQD CVAI+D K GVFVNG+FCKDP+   A+DFFFSGL  PGNT N++G + T  NV+QIPGLNT+GIS  RIDYAP+GQ PPH HPR SEI +++EGTLYVGFV+S+Q NN L AKVL+ GDVFVFP G+IHFQ NIGK  A A++ L+SQ  G +TIA+TVFG+NP I P+ L +AFQLD  +VK+LQ KF
Sbjct:    1 MRVSQSLIPFAIIALVLSFVNAYDPSPLQDFCVAIDDLK-GVFVNGRFCKDPERVDAKDFFFSGLNVPGNTNNQVGSNVTTVNVDQIPGLNTMGISLVRIDYAPHGQNPPHTHPRGSEILVLVEGTLYVGFVSSNQDNNRLFAKVLHPGDVFVFPIGMIHFQLNIGKIPAIAFAGLSSQNAGVITIANTVFGSNPPIYPELLARAFQLDANVVKELQAKF 219          
BLAST of CK937438 vs. ExPASy Swiss-Prot
Match: GL17_ARATH (Germin-like protein subfamily 1 member 7 OS=Arabidopsis thaliana GN=At3g05950 PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 9.431e-69
Identity = 127/197 (64.47%), Postives = 153/197 (77.66%), Query Frame = 2
Query:  128 DPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKF 718
            DP  LQD CVA++D   GVFVNGKFCKDPK  +AEDFF SGL   GNT NR+G + T+ NV++IPGLNTLG+S  RID+AP GQ PPH HPRA+EI +V+EGTL VGFVTS+Q NN L +KVL  GDVFVFP G+IHFQ N+G+TNA A++ L SQ PG +TIAD VFG+ PSI P+ L KAFQLD  +VK L+ +F
Sbjct:   26 DPSPLQDFCVAVDDAS-GVFVNGKFCKDPKYVKAEDFFTSGLNIAGNTINRVGSNVTNVNVDKIPGLNTLGVSLVRIDFAPGGQNPPHTHPRATEILVVVEGTLLVGFVTSNQDNNRLFSKVLYPGDVFVFPIGMIHFQVNVGRTNAVAFAGLGSQNPGTITIADAVFGSKPSIMPEILAKAFQLDVNVVKYLEARF 221          
BLAST of CK937438 vs. ExPASy Swiss-Prot
Match: GL19_ARATH (Putative germin-like protein subfamily 1 member 9 OS=Arabidopsis thaliana GN=At5g38910 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 6.113e-68
Identity = 130/221 (58.82%), Postives = 150/221 (67.87%), Query Frame = 2
Query:   59 MKVIQFLIGFXXXXXXXXXXXXTDPGHLQDVCVAINDPKDGVFVNGKFCKDPKLARAEDFFFSGLGKPGNTANRLGVDETDANVEQIPGLNTLGISAFRIDYAPYGQRPPHIHPRASEIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFI 721
            MK   FL               +DP  LQD CV +N P DGVFVNGKFCKDPKL   EDFFF+GL +      + G + T  NV  +PGLNTLGIS  RIDY  YGQ PPH HPRASE+  V  GTL+VGFVTS+   N L +K L +GDVFVFPQGLIHFQ N+GK  A A++ L+SQ PG +TIADTVFG+NP I+P FL  AFQ+DPKIV DLQ KFI
Sbjct:    1 MKSFSFLAVLSILAITLSLSKASDPSSLQDFCVGVNTPADGVFVNGKFCKDPKLVTVEDFFFTGLHEARPPNPKTGSNVTAVNVNNLPGLNTLGISLVRIDYGVYGQNPPHTHPRASEVLYVAVGTLFVGFVTSNP-ENRLFSKTLYEGDVFVFPQGLIHFQVNVGKYPAVAFAGLSSQNPGVITIADTVFGSNPQIDPSFLASAFQVDPKIVMDLQTKFI 220          
The following BLAST results are available for this feature:
BLAST of CK937438 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 87
Match NameE-valueIdentityDescription
GL117_ARATH6.743e-7568.84Germin-like protein subfamily 1 member 17 OS=Arabi... [more]
GL115_ARATH6.743e-7568.84Germin-like protein subfamily 1 member 15 OS=Arabi... [more]
GL114_ARATH1.502e-7468.34Germin-like protein subfamily 1 member 14 OS=Arabi... [more]
GL119_ARATH3.347e-7468.34Germin-like protein subfamily 1 member 19 OS=Arabi... [more]
GL113_ARATH3.347e-7468.34Germin-like protein subfamily 1 member 13 OS=Arabi... [more]
GL118_ARATH3.463e-7160.91Germin-like protein subfamily 1 member 18 OS=Arabi... [more]
GL120_ARATH4.523e-7160.91Germin-like protein subfamily 1 member 20 OS=Arabi... [more]
GL116_ARATH7.715e-7161.36Germin-like protein subfamily 1 member 16 OS=Arabi... [more]
GL17_ARATH9.431e-6964.47Germin-like protein subfamily 1 member 7 OS=Arabid... [more]
GL19_ARATH6.113e-6858.82Putative germin-like protein subfamily 1 member 9 ... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit albedo at 80 DAFB in pTriplEx2 vectorcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004780_F11 Developing fruit albedo at 80 DAFB in pTriplEx2 vector Citrus sinensis cDNA clone A80DAB0003_IVF_F11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK937438 ID=CK937438|Name=CK937438|organism=Citrus sinensis|type=EST|length=728bp
GGGGAATCACAACANNNGATTAAAGTTTGAGATAGGCACATCCTGTGACT
TAATCACCATGAAGGTAATTCAATTTCTTATAGGTTTTGCCCTCTTGGCT
TTGGCTTCTTCTTTGGCCTCTGCCACTGACCCTGGCCATCTTCAAGATGT
CTGTGTAGCCATCAATGACCCCAAGGATGGTGTGTTTGTGAATGGGAAGT
TCTGCAAGGACCCCAAGCTTGCGAGAGCAGAAGATTTCTTCTTCTCAGGG
CTAGGCAAGCCTGGAAACACAGCAAATCGACTTGGTGTTGATGAAACAGA
TGCAAATGTTGAGCAAATTCCAGGACTCAACACCCTTGGCATATCAGCAT
TCCGTATTGACTATGCACCATATGGCCAAAGGCCACCTCACATTCACCCC
CGTGCCAGCGAAATCTTCTTAGTCCTGGAAGGAACTCTTTATGTCGGTTT
TGTGACATCAGACCAACTGAATAACACACTCATCGCAAAAGTTCTAAATA
AGGGAGATGTTTTTGTGTTTCCACAAGGTTTGATTCACTTCCAATTCAAC
ATTGGAAAAACAAATGCAGCTGCCTATTCTGCTCTAAACAGCCAATTCCC
GGGTGAAGTTACCATAGCCGACACAGTCTTTGGAGCCAATCCTTCAATCA
ATCCCGATTTTCTTGGCAAGGCATTCCAGTTGGACCCAAAGATAGTGAAA
GATCTTCAAAATAAGTTCATTAATGGCA
back to top