CK937435

Overview
NameCK937435
Unique NameCK937435
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length663
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK937435_ssr74 microsatellite CK937435_ssr74:74..85. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2029 contig Csv1_Contig2029:1..663. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: IF4E2_WHEAT (Eukaryotic translation initiation factor 4E-2 OS=Triticum aestivum PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 5.168e-76
Identity = 124/162 (76.54%), Postives = 146/162 (90.12%), Query Frame = 1
Query:  106 PHKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWSVTSNRKANLDTMWLETMMALIGEQFDEADEICGVVASVRQRQDKLALWTKTAANEAAQMGIGKKWKEILDLTDRITYSFH 591
            PHKL+R+WTFW+D  +KPK GAAWG+S++K YTFDTVEEFWCLY+QIF+PS+L  +ADFHLFK G+EPKWEDPECANGGKW+V S+RK NLDTMWLET MALIGEQFDE+ EICGVVASVRQRQDKL+LWTKTA+NEA Q+ IGKKWKE++D  D++ YSFH
Sbjct:   32 PHKLQRQWTFWYDIQTKPKPGAAWGTSLKKGYTFDTVEEFWCLYDQIFRPSKLVGSADFHLFKAGVEPKWEDPECANGGKWTVISSRKTNLDTMWLETCMALIGEQFDESQEICGVVASVRQRQDKLSLWTKTASNEAVQVDIGKKWKEVIDYNDKMVYSFH 193          
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: IF4E2_ORYSJ (Eukaryotic translation initiation factor 4E-2 OS=Oryza sativa subsp. japonica GN=Os10g0467600 PE=2 SV=2)

HSP 1 Score: 274.633 bits (701), Expect = 3.135e-73
Identity = 120/162 (74.07%), Postives = 142/162 (87.65%), Query Frame = 1
Query:  106 PHKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWSVTSNRKANLDTMWLETMMALIGEQFDEADEICGVVASVRQRQDKLALWTKTAANEAAQMGIGKKWKEILDLTDRITYSFH 591
            PHKL R+W FW+D  SKPK GAAWG+S+RK YTFDTVEEFW LY+QIF+PS++ +NADFHLFK G+EPKWEDPECANGGKW+V  +RK  L+ MWLET+MALIGEQFDE++EICGVVASVRQR DKLALWT+TA+NEA Q+ IGKKWKEI+D  D++ YSFH
Sbjct:   29 PHKLHRQWAFWYDIQSKPKPGAAWGTSLRKAYTFDTVEEFWGLYDQIFRPSKVTVNADFHLFKAGVEPKWEDPECANGGKWTVPCSRKTTLENMWLETLMALIGEQFDESEEICGVVASVRQRGDKLALWTRTASNEAVQVNIGKKWKEIVDYNDKMVYSFH 190          
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: IF4E2_MAIZE (Eukaryotic translation initiation factor 4E-2 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 2.654e-72
Identity = 116/162 (71.60%), Postives = 141/162 (87.04%), Query Frame = 1
Query:  106 PHKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWSVTSNRKANLDTMWLETMMALIGEQFDEADEICGVVASVRQRQDKLALWTKTAANEAAQMGIGKKWKEILDLTDRITYSFH 591
            PHKL R+WTFW+D  +K K GAAWG+S++K YTFDTVEEFW +Y+QIF+PS+L  NADFHLFK G+EPKWEDPECANGGKW+V  NRKA  +TMWLET+MALIGEQFDE ++ICG+VASVR R DKLALWT+TA+NEA Q+ IGKKWK+++D  D+ITY+FH
Sbjct:   39 PHKLHRQWTFWYDIQTKTKSGAAWGTSLKKAYTFDTVEEFWSMYDQIFRPSKLSGNADFHLFKAGVEPKWEDPECANGGKWTVPCNRKATFETMWLETLMALIGEQFDETEDICGIVASVRARGDKLALWTRTASNEAVQVNIGKKWKDVIDYNDKITYTFH 200          
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: IF4E2_ARATH (Eukaryotic translation initiation factor 4E-2 OS=Arabidopsis thaliana GN=EIF4E2 PE=1 SV=2)

HSP 1 Score: 258.84 bits (660), Expect = 1.780e-68
Identity = 122/169 (72.19%), Postives = 144/169 (85.21%), Query Frame = 1
Query:   97 QSQPHKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWS--VTSNRKANLDTMWLETMMALIGEQFDEADEICGVVASVR--QRQDKLALWTKTAANEAAQMGIGKKWKEILDLTDRITYSFH 591
            + QPHKLERKW+FWFDN SK  +GAAWG+S+RK YTFDTVE+FW L+E IF+ S+L  NA+ HLFK G+EPKWEDPECANGGKW+  VT+NRK  LD  WLET+MALIGEQFDEADEICGVVASVR   +QDKL+LWT+T +NEA  MGIGKKWKEILD+TD+IT++ H
Sbjct:   22 EKQPHKLERKWSFWFDNQSK--KGAAWGASLRKAYTFDTVEDFWGLHETIFQTSKLTANAEIHLFKAGVEPKWEDPECANGGKWTWVVTANRKEALDKGWLETLMALIGEQFDEADEICGVVASVRPQSKQDKLSLWTRTKSNEAVLMGIGKKWKEILDVTDKITFNNH 188          
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: IF4E1_ORYSJ (Eukaryotic translation initiation factor 4E-1 OS=Oryza sativa subsp. japonica GN=Os01g0970400 PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 3.482e-56
Identity = 100/170 (58.82%), Postives = 121/170 (71.18%), Query Frame = 1
Query:   91 PPQSQP---HKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWSVTSNRKANLDTMWLETMMALIGEQFDEADEICGVVASVRQRQDKLALWTKTAANEAAQMGIGKKWKEILDLTDRITYSFH 591
            PPQ+ P   H LE  WTFWFDN     + A WGSS+R ++TF TVE+FW LY  I  PS+L + ADFH FK  IEPKWEDP CANGGKW+ +  R    DTMWL T++A+IGEQFD  DEICG V SVR +Q+++A+WTK AANEAAQ+ IGK+WKE LD  D I +  H
Sbjct:   43 PPQANPAAPHPLEHAWTFWFDNPQGKSKQATWGSSIRPIHTFSTVEDFWSLYNNIHHPSKLVVGADFHCFKNKIEPKWEDPICANGGKWTFSCGR-GKSDTMWLHTLLAMIGEQFDYGDEICGAVVSVRGKQERIAIWTKNAANEAAQISIGKQWKEFLDYKDSIGFIVH 211          
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: IF4E1_MAIZE (Eukaryotic translation initiation factor 4E-1 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.323e-55
Identity = 98/167 (58.68%), Postives = 119/167 (71.26%), Query Frame = 1
Query:   91 PPQSQPHKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWSVTSNRKANLDTMWLETMMALIGEQFDEADEICGVVASVRQRQDKLALWTKTAANEAAQMGIGKKWKEILDLTDRITYSFH 591
            P     H LE  WTFWFDN     + AAWGSS+R ++TF TVEEFW LY  I  PS+L + ADFH FK  IEPKWEDP CANGGKW+++  R    DT WL T++A+IGEQFD  DEICG V SVR +Q+++A+WTK AANEAAQ+ IGK+WKE+LD  D I +  H
Sbjct:   37 PSPPATHPLEHSWTFWFDNPQSKSKQAAWGSSIRPIHTFSTVEEFWGLYNNINHPSKLIVGADFHCFKNKIEPKWEDPICANGGKWTISCGR-GKSDTFWLHTLLAMIGEQFDYGDEICGAVVSVRGKQERIAIWTKNAANEAAQVSIGKQWKELLDYKDSIGFIVH 202          
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: IF4E1_WHEAT (Eukaryotic translation initiation factor 4E-1 OS=Triticum aestivum PE=1 SV=3)

HSP 1 Score: 211.075 bits (536), Expect = 4.257e-54
Identity = 94/161 (58.39%), Postives = 116/161 (72.05%), Query Frame = 1
Query:  109 HKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWSVTSNRKANLDTMWLETMMALIGEQFDEADEICGVVASVRQRQDKLALWTKTAANEAAQMGIGKKWKEILDLTDRITYSFH 591
            H LE  WTFWFDN     +  AWGS++  ++TF TVE+FW LY  I  PS+L + ADFH FK  IEPKWEDP CANGGKW+++  R    DT WL T++A+IGEQFD  DEICG V SVRQ+Q+++A+WTK AANEAAQ+ IGK+WKE LD  D I +  H
Sbjct:   40 HPLENAWTFWFDNPQGKSRQVAWGSTIHPIHTFSTVEDFWGLYNNIHNPSKLNVGADFHCFKNKIEPKWEDPICANGGKWTISCGR-GKSDTFWLHTLLAMIGEQFDFGDEICGAVVSVRQKQERVAIWTKNAANEAAQISIGKQWKEFLDYKDSIGFIVH 199          
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: IF4E1_ARATH (Eukaryotic translation initiation factor 4E-1 OS=Arabidopsis thaliana GN=EIF4E1 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.405e-51
Identity = 89/163 (54.60%), Postives = 118/163 (72.39%), Query Frame = 1
Query:  103 QPHKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWSVTSNRKANLDTMWLETMMALIGEQFDEADEICGVVASVRQRQDKLALWTKTAANEAAQMGIGKKWKEILDLTDRITYSFH 591
            + H LE  WTFWFDN +   +  +WGSS+R V+TF TVEEFW LY  +  PS+L   ADF+ FK  IEPKWEDP CANGGKW++T  ++ + D  WL T++ALIGEQFD  DEICG V ++R +Q+++++WTK A+NEAAQ+ IGK+WKE LD  + I +  H
Sbjct:   58 ESHPLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKWTMTFPKEKS-DKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIH 219          
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: IF4E4_ARATH (Putative eukaryotic translation initiation factor 4E-4 OS=Arabidopsis thaliana GN=At1g29550 PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 5.385e-49
Identity = 87/161 (54.04%), Postives = 109/161 (67.70%), Query Frame = 1
Query:  109 HKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWSVTSNRKANLDTMWLETMMALIGEQFDEADEICGVVASVRQRQDKLALWTKTAANEAAQMGIGKKWKEILDLTDRITYSFH 591
            H  +  WTFWFDN S       WGSS+R +YTF T+EEFW LY  I  P++    AD + FK  IEPKWEDP CANGGKWS+    KA L+  WL T++AL+GEQFD+ DEICG V + R R D+++LWTK AANE AQ+ IGK+WKE+L   + I +  H
Sbjct:   65 HCFQNSWTFWFDNPSSKSNQVIWGSSLRSLYTFGTIEEFWSLYNNIHPPTKWVSGADLYCFKDKIEPKWEDPICANGGKWSMMF-PKATLECNWLNTLLALVGEQFDQGDEICGAVLNFRARGDRISLWTKNAANEEAQLSIGKQWKELLGYNETIGFIVH 224          
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: IF4E5_ARATH (Eukaryotic translation initiation factor 4E-5 OS=Arabidopsis thaliana GN=At1g29590 PE=2 SV=2)

HSP 1 Score: 192.971 bits (489), Expect = 1.200e-48
Identity = 86/161 (53.42%), Postives = 110/161 (68.32%), Query Frame = 1
Query:  109 HKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWSVTSNRKANLDTMWLETMMALIGEQFDEADEICGVVASVRQRQDKLALWTKTAANEAAQMGIGKKWKEILDLTDRITYSFH 591
            H  +  WTFWFDN S       WGSS+R +YTF T+EEFW LY  I  P++    +D + FK  IEPKWEDP CANGGKW++   R A L++ WL T++AL+GEQFD+ DEICG V + R R D+++LWTK AANE AQ+ IGK+WKE+L   D I +  H
Sbjct:   65 HCFQNSWTFWFDNPSSKSNQVIWGSSLRSLYTFATIEEFWSLYNNIHPPTKWVSGSDLYCFKDKIEPKWEDPICANGGKWTMFFPR-ATLESNWLNTLLALVGEQFDQGDEICGAVLNFRTRGDRISLWTKKAANEEAQLSIGKQWKELLGYNDTIGFIVH 224          
The following BLAST results are available for this feature:
BLAST of CK937435 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 43
Match NameE-valueIdentityDescription
IF4E2_WHEAT5.168e-7676.54Eukaryotic translation initiation factor 4E-2 OS=T... [more]
IF4E2_ORYSJ3.135e-7374.07Eukaryotic translation initiation factor 4E-2 OS=O... [more]
IF4E2_MAIZE2.654e-7271.60Eukaryotic translation initiation factor 4E-2 OS=Z... [more]
IF4E2_ARATH1.780e-6872.19Eukaryotic translation initiation factor 4E-2 OS=A... [more]
IF4E1_ORYSJ3.482e-5658.82Eukaryotic translation initiation factor 4E-1 OS=O... [more]
IF4E1_MAIZE1.323e-5558.68Eukaryotic translation initiation factor 4E-1 OS=Z... [more]
IF4E1_WHEAT4.257e-5458.39Eukaryotic translation initiation factor 4E-1 OS=T... [more]
IF4E1_ARATH4.405e-5154.60Eukaryotic translation initiation factor 4E-1 OS=A... [more]
IF4E4_ARATH5.385e-4954.04Putative eukaryotic translation initiation factor ... [more]
IF4E5_ARATH1.200e-4853.42Eukaryotic translation initiation factor 4E-5 OS=A... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit albedo at 80 DAFB in pTriplEx2 vectorcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004780_F07 Developing fruit albedo at 80 DAFB in pTriplEx2 vector Citrus sinensis cDNA clone A80DAB0003_IVF_F07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK937435 ID=CK937435|Name=CK937435|organism=Citrus sinensis|type=EST|length=663bp
GGGGGGGAAAAAAATATAATTAATAGAAACAAAGAAGAGAGAGATATGGC
AACAAGTGAGGAGGCAAGCGCGACGGCGGCGGCGGAGGTGCCGCCGCAAT
CACAGCCGCACAAGCTCGAGAGAAAATGGACGTTTTGGTTCGACAACATA
TCAAAGCCCAAACAGGGCGCCGCGTGGGGCTCCTCCATGCGCAAAGTCTA
CACCTTCGACACTGTCGAAGAATTTTGGTGTTTGTATGAACAGATATTCA
AGCCAAGCCGGTTGCCAATGAATGCGGATTTCCATTTGTTCAAAACTGGG
ATAGAACCAAAGTGGGAAGATCCTGAGTGTGCGAATGGAGGAAAGTGGTC
GGTCACTAGCAACAGGAAGGCTAACCTTGATACCATGTGGCTTGAAACAA
TGATGGCCCTGATTGGAGAGCAATTTGATGAGGCGGATGAGATTTGTGGG
GTTGTTGCTAGTGTACGCCAGAGGCAGGACAAACTTGCCTTATGGACCAA
GACAGCAGCAAATGAAGCTGCTCAGATGGGCATTGGAAAGAAGTGGAAGG
AGATCCTCGATCTCACTGATAGGATCACTTACAGCTTCCACGATGACTCT
AGAAGGGATCGATCAGTGAAAAGTCGATACAGTGTGTGAACTCAAAAGTG
ACCGTTTTGTCGC
back to top