FC921775

Overview
NameFC921775
Unique NameFC921775
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length261
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1218 contig Csv1_Contig1218:294..554. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC921775 vs. ExPASy Swiss-Prot
Match: RSBQ_BACSU (Sigma factor sigB regulation protein rsbQ OS=Bacillus subtilis GN=rsbQ PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.451e-19
Identity = 42/86 (48.84%), Postives = 61/86 (70.93%), Query Frame = 2
Query:    5 TLDAYVDDLLNILDTLGVNRCAYVGHSVSAMIGLLASIRRPDLFTKLILIGASPRFLND-EDYHGGFEEAEIDKVFRAMEANYEAW 259
            TLD Y  D+L++ + L +    +VGHSV A+IG+LASIRRP+LF+ L+++G SP +LND  +Y+GGFEE ++  +   ME NY  W
Sbjct:   70 TLDGYAQDVLDVCEALDLKETVFVGHSVGALIGMLASIRRPELFSHLVMVGPSPCYLNDPPEYYGGFEEEQLLGLLEMMEKNYIGW 155          
The following BLAST results are available for this feature:
BLAST of FC921775 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
RSBQ_BACSU4.451e-1948.84Sigma factor sigB regulation protein rsbQ OS=Bacil... [more]
back to top
Libraries
Library NameType
RindPdigScdna_library
Properties
Property NameValue
Genbank descriptionC06052B11T7 RindPdigS Citrus sinensis cDNA clone C06052B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC921775 ID=FC921775|Name=FC921775|organism=Citrus sinensis|type=EST|length=261bp
CACAACTCTTGATGCCTACGTTGACGATTTGCTCAACATTCTAGACACCC
TTGGCGTCAACCGCTGCGCCTACGTTGGCCACTCTGTCTCCGCCATGATC
GGGCTCTTGGCCTCCATTCGCCGCCCTGACCTCTTCACCAAGCTCATCCT
CATCGGTGCTTCTCCAAGGTTCTTGAACGACGAAGATTATCACGGGGGAT
TTGAGGAAGCTGAAATTGACAAAGTGTTTAGGGCAATGGAGGCGAATTAT
GAGGCATGGGC
back to top