EY665875
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY665875 vs. ExPASy Swiss-Prot
Match: XPP1_BOVIN (Xaa-Pro aminopeptidase 1 OS=Bos taurus GN=XPNPEP1 PE=2 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 2.352e-11 Identity = 30/41 (73.17%), Postives = 35/41 (85.37%), Query Frame = 3 Query: 405 IDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTK 527 I AYIIPS DAHQSE+IA C RRA++SGF GSAGTA+VT+ Sbjct: 27 IQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIVTE 67 HSP 2 Score: 25.0238 bits (53), Expect = 2.352e-11 Identity = 9/18 (50.00%), Postives = 13/18 (72.22%), Query Frame = 2 Query: 563 FFRAEKQLSSSWILMRSG 616 F +A KQ+ S+W LM+ G Sbjct: 79 FLQAAKQMDSNWTLMKMG 96
BLAST of EY665875 vs. ExPASy Swiss-Prot
Match: XPP1_HUMAN (Xaa-Pro aminopeptidase 1 OS=Homo sapiens GN=XPNPEP1 PE=1 SV=3) HSP 1 Score: 64.3142 bits (155), Expect = 3.053e-11 Identity = 29/41 (70.73%), Postives = 35/41 (85.37%), Query Frame = 3 Query: 405 IDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTK 527 I AYIIPS DAHQSE+IA C RRA++SGF GSAGTA++T+ Sbjct: 27 IQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITE 67 HSP 2 Score: 25.0238 bits (53), Expect = 3.053e-11 Identity = 9/18 (50.00%), Postives = 13/18 (72.22%), Query Frame = 2 Query: 563 FFRAEKQLSSSWILMRSG 616 F +A KQ+ S+W LM+ G Sbjct: 79 FLQAAKQMDSNWTLMKMG 96
BLAST of EY665875 vs. ExPASy Swiss-Prot
Match: XPP1_RAT (Xaa-Pro aminopeptidase 1 OS=Rattus norvegicus GN=Xpnpep1 PE=1 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 5.144e-11 Identity = 34/60 (56.67%), Postives = 41/60 (68.33%), Query Frame = 3 Query: 357 EKLRALRELFSRP---GVNIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTK 527 E LR LR+ I AYIIPS DAHQSE+IA C RRA++SGF GSAGTA++T+ Sbjct: 8 ELLRQLRQAMRNSECVAEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITE 67 HSP 2 Score: 23.8682 bits (50), Expect = 5.144e-11 Identity = 8/18 (44.44%), Postives = 13/18 (72.22%), Query Frame = 2 Query: 563 FFRAEKQLSSSWILMRSG 616 F +A KQ+ ++W LM+ G Sbjct: 79 FLQAAKQMDNNWTLMKMG 96
BLAST of EY665875 vs. ExPASy Swiss-Prot
Match: XPP1_MOUSE (Xaa-Pro aminopeptidase 1 OS=Mus musculus GN=Xpnpep1 PE=2 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 5.144e-11 Identity = 34/60 (56.67%), Postives = 41/60 (68.33%), Query Frame = 3 Query: 357 EKLRALRELFSRP---GVNIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTK 527 E LR LR+ I AYIIPS DAHQSE+IA C RRA++SGF GSAGTA++T+ Sbjct: 8 ELLRQLRQAMRNSEYVAEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITE 67 HSP 2 Score: 23.8682 bits (50), Expect = 5.144e-11 Identity = 8/18 (44.44%), Postives = 13/18 (72.22%), Query Frame = 2 Query: 563 FFRAEKQLSSSWILMRSG 616 F +A KQ+ ++W LM+ G Sbjct: 79 FLQAAKQMDNNWTLMKMG 96 The following BLAST results are available for this feature:
BLAST of EY665875 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY665875 ID=EY665875; Name=EY665875; organism=Citrus sinensis; type=EST; length=870bpback to top |