FC921771

Overview
NameFC921771
Unique NameFC921771
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length341
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10253 contig Csv1_Contig10253:31..371. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC921771 vs. ExPASy Swiss-Prot
Match: AROF_ARATH (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=DHS1 PE=2 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 2.729e-13
Identity = 36/64 (56.25%), Postives = 47/64 (73.44%), Query Frame = 1
Query:  148 QPNFSLHPANTTKPRSLVQPITAVHAAQPAKNSAAVKESSSSPAKASGKWALEGWKTKKALQLP 339
            Q +F+ HPA  TKP+S V  +TAVHAA+PA+N+ +VKES +S +  + KW  E WK KKALQLP
Sbjct:   27 QSSFTFHPAVNTKPKS-VNLVTAVHAAEPARNAVSVKESVASSSSGALKWTPESWKLKKALQLP 89          
The following BLAST results are available for this feature:
BLAST of FC921771 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
AROF_ARATH2.729e-1356.25Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
back to top
Libraries
Library NameType
RindPdigScdna_library
Properties
Property NameValue
Genbank descriptionC06052B07T7 RindPdigS Citrus sinensis cDNA clone C06052B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC921771 ID=FC921771|Name=FC921771|organism=Citrus sinensis|type=EST|length=341bp
CAATCAATCATTCACTCTTCCAATTCCAGAGAAGACAGAGAGAATTAAAA
AAAAAAAAGGACCCCAATGGCTCTCTCAAATGCATCATCAACTCTTTCTT
CCAAGTCTCTCTATGCCAATACTCACACTCTTGCGTCCAAGCCTCACCAA
CCAAATTTCTCTCTTCACCCCGCCAACACCACCAAACCAAGATCTCTAGT
GCAACCCATCACAGCCGTCCATGCAGCTCAACCCGCCAAGAACTCTGCTG
CTGTTAAGGAATCATCCTCGTCACCGGCAAAGGCGTCCGGGAAATGGGCG
CTGGAGGGATGGAAGACCAAGAAAGCCCTGCAGCTTCCTGA
back to top