FC921769

Overview
NameFC921769
Unique NameFC921769
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length221
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1574 contig Csv1_Contig1574:1483..1702. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC921769 vs. ExPASy Swiss-Prot
Match: AROF_TOBAC (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Nicotiana tabacum GN=DHAPS-1 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 4.264e-17
Identity = 29/34 (85.29%), Postives = 30/34 (88.24%), Query Frame = 1
Query:    1 HLHMTGPNVTECISGSRTVTFNDLSSPYHTHCDP 102
            HL MTG NVTECI GSRTVTF+DLSS YHTHCDP
Sbjct:  478 HLEMTGQNVTECIGGSRTVTFDDLSSRYHTHCDP 511          

HSP 2 Score: 40.0466 bits (92), Expect = 4.264e-17
Identity = 19/23 (82.61%), Postives = 23/23 (100.00%), Query Frame = 2
Query:  104 RLHASQSLELAFLIAERLQKRRI 172
            RL+ASQSLELAF+IAERL+KRR+
Sbjct:  512 RLNASQSLELAFIIAERLRKRRL 534          
BLAST of FC921769 vs. ExPASy Swiss-Prot
Match: AROG_ARATH (Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=DHS2 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 4.270e-17
Identity = 27/34 (79.41%), Postives = 30/34 (88.24%), Query Frame = 1
Query:    1 HLHMTGPNVTECISGSRTVTFNDLSSPYHTHCDP 102
            HL MTG NVTEC+ GSRT+T+NDLSS YHTHCDP
Sbjct:  440 HLEMTGQNVTECVGGSRTITYNDLSSRYHTHCDP 473          

HSP 2 Score: 40.0466 bits (92), Expect = 4.270e-17
Identity = 19/23 (82.61%), Postives = 23/23 (100.00%), Query Frame = 2
Query:  104 RLHASQSLELAFLIAERLQKRRI 172
            RL+ASQSLELAF+IAERL+KRR+
Sbjct:  474 RLNASQSLELAFIIAERLRKRRL 496          
BLAST of FC921769 vs. ExPASy Swiss-Prot
Match: AROG_SOLLC (Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 9.367e-17
Identity = 29/34 (85.29%), Postives = 30/34 (88.24%), Query Frame = 1
Query:    1 HLHMTGPNVTECISGSRTVTFNDLSSPYHTHCDP 102
            HL MTG NVTECI GSRTVTF+DLSS YHTHCDP
Sbjct:  477 HLEMTGQNVTECIGGSRTVTFDDLSSRYHTHCDP 510          

HSP 2 Score: 38.891 bits (89), Expect = 9.367e-17
Identity = 18/23 (78.26%), Postives = 23/23 (100.00%), Query Frame = 2
Query:  104 RLHASQSLELAFLIAERLQKRRI 172
            RL+ASQSLEL+F+IAERL+KRR+
Sbjct:  511 RLNASQSLELSFIIAERLRKRRL 533          
BLAST of FC921769 vs. ExPASy Swiss-Prot
Match: AROF_SOLTU (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Solanum tuberosum GN=SHKA PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 9.368e-17
Identity = 29/34 (85.29%), Postives = 30/34 (88.24%), Query Frame = 1
Query:    1 HLHMTGPNVTECISGSRTVTFNDLSSPYHTHCDP 102
            HL MTG NVTECI GSRTVTF+DLSS YHTHCDP
Sbjct:  477 HLEMTGQNVTECIGGSRTVTFDDLSSRYHTHCDP 510          

HSP 2 Score: 38.891 bits (89), Expect = 9.368e-17
Identity = 18/23 (78.26%), Postives = 23/23 (100.00%), Query Frame = 2
Query:  104 RLHASQSLELAFLIAERLQKRRI 172
            RL+ASQSLEL+F+IAERL+KRR+
Sbjct:  511 RLNASQSLELSFIIAERLRKRRL 533          
BLAST of FC921769 vs. ExPASy Swiss-Prot
Match: AROF_ARATH (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=DHS1 PE=2 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 2.058e-16
Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = 1
Query:    1 HLHMTGPNVTECISGSRTVTFNDLSSPYHTHCDP 102
            HL MTG NVTECI GSRTVT++DLSS YHTHCDP
Sbjct:  463 HLEMTGQNVTECIGGSRTVTYDDLSSRYHTHCDP 496          

HSP 2 Score: 38.891 bits (89), Expect = 2.058e-16
Identity = 18/22 (81.82%), Postives = 22/22 (100.00%), Query Frame = 2
Query:  104 RLHASQSLELAFLIAERLQKRR 169
            RL+ASQSLELAF++AERL+KRR
Sbjct:  497 RLNASQSLELAFIVAERLRKRR 518          
BLAST of FC921769 vs. ExPASy Swiss-Prot
Match: AROG_ORYSJ (Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=DAHPS2 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.475e-16
Identity = 28/34 (82.35%), Postives = 29/34 (85.29%), Query Frame = 1
Query:    1 HLHMTGPNVTECISGSRTVTFNDLSSPYHTHCDP 102
            HL MTG NVTECI GSRTVTF+DLS  YHTHCDP
Sbjct:  468 HLEMTGQNVTECIGGSRTVTFDDLSDRYHTHCDP 501          

HSP 2 Score: 38.5058 bits (88), Expect = 3.475e-16
Identity = 18/23 (78.26%), Postives = 23/23 (100.00%), Query Frame = 2
Query:  104 RLHASQSLELAFLIAERLQKRRI 172
            RL+ASQSLELAF+IAERL++RR+
Sbjct:  502 RLNASQSLELAFIIAERLRRRRM 524          
BLAST of FC921769 vs. ExPASy Swiss-Prot
Match: AROF_ORYSJ (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=DAHPS1 PE=2 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 2.175e-15
Identity = 27/34 (79.41%), Postives = 28/34 (82.35%), Query Frame = 1
Query:    1 HLHMTGPNVTECISGSRTVTFNDLSSPYHTHCDP 102
            HL MTG NVTECI GSRTVTF+DL   YHTHCDP
Sbjct:  482 HLEMTGQNVTECIGGSRTVTFDDLGDRYHTHCDP 515          

HSP 2 Score: 37.3502 bits (85), Expect = 2.175e-15
Identity = 17/23 (73.91%), Postives = 23/23 (100.00%), Query Frame = 2
Query:  104 RLHASQSLELAFLIAERLQKRRI 172
            RL+ASQSLEL+F+IAERL+++RI
Sbjct:  516 RLNASQSLELSFIIAERLRRKRI 538          
BLAST of FC921769 vs. ExPASy Swiss-Prot
Match: AROG_SOLTU (Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Solanum tuberosum GN=SHKB PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.179e-15
Identity = 27/34 (79.41%), Postives = 29/34 (85.29%), Query Frame = 1
Query:    1 HLHMTGPNVTECISGSRTVTFNDLSSPYHTHCDP 102
            HL MTG NVTECI GSRTVT++DL S YHTHCDP
Sbjct:  450 HLEMTGQNVTECIGGSRTVTYDDLGSRYHTHCDP 483          

HSP 2 Score: 36.965 bits (84), Expect = 2.179e-15
Identity = 16/23 (69.57%), Postives = 23/23 (100.00%), Query Frame = 2
Query:  104 RLHASQSLELAFLIAERLQKRRI 172
            RL+ASQSLEL+F++AERL++RR+
Sbjct:  484 RLNASQSLELSFIVAERLRRRRM 506          
BLAST of FC921769 vs. ExPASy Swiss-Prot
Match: AROF_SOLLC (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.179e-15
Identity = 27/34 (79.41%), Postives = 29/34 (85.29%), Query Frame = 1
Query:    1 HLHMTGPNVTECISGSRTVTFNDLSSPYHTHCDP 102
            HL MTG NVTECI GSRTVT++DL S YHTHCDP
Sbjct:  450 HLEMTGQNVTECIGGSRTVTYDDLGSRYHTHCDP 483          

HSP 2 Score: 36.965 bits (84), Expect = 2.179e-15
Identity = 16/23 (69.57%), Postives = 23/23 (100.00%), Query Frame = 2
Query:  104 RLHASQSLELAFLIAERLQKRRI 172
            RL+ASQSLEL+F++AERL++RR+
Sbjct:  484 RLNASQSLELSFIVAERLRRRRM 506          
The following BLAST results are available for this feature:
BLAST of FC921769 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
AROF_TOBAC4.264e-1785.29Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROG_ARATH4.270e-1779.41Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chl... [more]
AROG_SOLLC9.367e-1785.29Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chl... [more]
AROF_SOLTU9.368e-1785.29Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROF_ARATH2.058e-1682.35Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROG_ORYSJ3.475e-1682.35Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chl... [more]
AROF_ORYSJ2.175e-1579.41Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROG_SOLTU2.179e-1579.41Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chl... [more]
AROF_SOLLC2.179e-1579.41Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
back to top
Libraries
Library NameType
RindPdigScdna_library
Properties
Property NameValue
Genbank descriptionC06052B05T7 RindPdigS Citrus sinensis cDNA clone C06052B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC921769 ID=FC921769|Name=FC921769|organism=Citrus sinensis|type=EST|length=221bp
CACCTGCATATGACCGGCCCGAATGTGACAGAGTGCATCAGTGGGTCCAG
AACAGTGACATTCAACGACTTGAGTTCACCCTACCACACCCACTGTGACC
CCTAGGCTCCATGCTTCCCAGTCACTTGAGCTTGCCTTCCTCATTGCCGA
GCGCCTCCAAAAGAGGAGGATTAGCTCACAGCAACCTCTTGCCTCTTCTT
CTCTCCTGTAGAATGGCCCGA
back to top