FC921764

Overview
NameFC921764
Unique NameFC921764
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length324
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC921764 vs. ExPASy Swiss-Prot
Match: RS5_NEUCR (40S ribosomal protein S5 OS=Neurospora crassa GN=rps-5 PE=3 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 7.796e-24
Identity = 58/70 (82.86%), Postives = 63/70 (90.00%), Query Frame = 1
Query:    7 RRQAVHVSPLRRVP*NLSLLTIGAREASFRNIKSIAECPAEELINAAKSSSHSYAIKKKDELERVAQSNR 216
            RRQAV VSPLRRV   ++LLT GAREASFRN+KSIAEC AEELINAAK SS+SYAIKKKDELERVA+SNR
Sbjct:  144 RRQAVDVSPLRRVNQAIALLTTGAREASFRNVKSIAECLAEELINAAKGSSNSYAIKKKDELERVAKSNR 213          
BLAST of FC921764 vs. ExPASy Swiss-Prot
Match: RS5B_SCHPO (40S ribosomal protein S5-B OS=Schizosaccharomyces pombe GN=rps5b PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.737e-23
Identity = 56/70 (80.00%), Postives = 64/70 (91.43%), Query Frame = 1
Query:    7 RRQAVHVSPLRRVP*NLSLLTIGAREASFRNIKSIAECPAEELINAAKSSSHSYAIKKKDELERVAQSNR 216
            RRQAV VSPLRRV   L+L+TIGAREA+FRN+KSI+EC AEE+INAAK SS+SYAIKKKDELERVA+SNR
Sbjct:  134 RRQAVDVSPLRRVNQALALITIGAREAAFRNVKSISECLAEEIINAAKGSSNSYAIKKKDELERVAKSNR 203          
BLAST of FC921764 vs. ExPASy Swiss-Prot
Match: RS5A_SCHPO (40S ribosomal protein S5-A OS=Schizosaccharomyces pombe GN=rps5a PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.737e-23
Identity = 56/70 (80.00%), Postives = 64/70 (91.43%), Query Frame = 1
Query:    7 RRQAVHVSPLRRVP*NLSLLTIGAREASFRNIKSIAECPAEELINAAKSSSHSYAIKKKDELERVAQSNR 216
            RRQAV VSPLRRV   L+L+TIGAREA+FRN+KSI+EC AEE+INAAK SS+SYAIKKKDELERVA+SNR
Sbjct:  134 RRQAVDVSPLRRVNQALALITIGAREAAFRNVKSISECLAEEIINAAKGSSNSYAIKKKDELERVAKSNR 203          
BLAST of FC921764 vs. ExPASy Swiss-Prot
Match: RS5_YEAST (40S ribosomal protein S5 OS=Saccharomyces cerevisiae GN=RPS5 PE=1 SV=3)

HSP 1 Score: 103.99 bits (258), Expect = 2.508e-22
Identity = 57/70 (81.43%), Postives = 62/70 (88.57%), Query Frame = 1
Query:    7 RRQAVHVSPLRRVP*NLSLLTIGAREASFRNIKSIAECPAEELINAAKSSSHSYAIKKKDELERVAQSNR 216
            RRQAV VSPLRRV   ++LLTIGAREA+FRNIK+IAE  AEELINAAK SS SYAIKKKDELERVA+SNR
Sbjct:  156 RRQAVDVSPLRRVNQAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELERVAKSNR 225          
BLAST of FC921764 vs. ExPASy Swiss-Prot
Match: RS5_CICAR (40S ribosomal protein S5 (Fragment) OS=Cicer arietinum GN=RPS5 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 3.275e-22
Identity = 54/70 (77.14%), Postives = 62/70 (88.57%), Query Frame = 1
Query:    7 RRQAVHVSPLRRVP*NLSLLTIGAREASFRNIKSIAECPAEELINAAKSSSHSYAIKKKDELERVAQSNR 216
            RRQAV +SPLRRV   + LLT GAREA+FRNIKSIAEC A+ELINAAK SS+SYAIKKKDE+ERVA++NR
Sbjct:  128 RRQAVDISPLRRVNQAIYLLTTGAREAAFRNIKSIAECLADELINAAKGSSNSYAIKKKDEIERVAKANR 197          
BLAST of FC921764 vs. ExPASy Swiss-Prot
Match: RS51_ARATH (40S ribosomal protein S5-1 OS=Arabidopsis thaliana GN=RPS5A PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 7.297e-22
Identity = 53/70 (75.71%), Postives = 62/70 (88.57%), Query Frame = 1
Query:    7 RRQAVHVSPLRRVP*NLSLLTIGAREASFRNIKSIAECPAEELINAAKSSSHSYAIKKKDELERVAQSNR 216
            RRQAV +SPLRRV   + LLT GAREA+FRNIK+IAEC A+ELINAAK SS+SYAIKKKDE+ERVA++NR
Sbjct:  138 RRQAVDISPLRRVNQAIFLLTTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDEIERVAKANR 207          
BLAST of FC921764 vs. ExPASy Swiss-Prot
Match: RS5_PODCA (40S ribosomal protein S5 OS=Podocoryne carnea GN=RPS5 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 9.530e-22
Identity = 55/70 (78.57%), Postives = 61/70 (87.14%), Query Frame = 1
Query:    7 RRQAVHVSPLRRVP*NLSLLTIGAREASFRNIKSIAECPAEELINAAKSSSHSYAIKKKDELERVAQSNR 216
            RRQAV V+PLRRV   + LL  GAREASFRNIKSIAEC A+ELINAA+ SS+SYAIKKKDELERVA+SNR
Sbjct:  141 RRQAVDVAPLRRVNQAIWLLCTGAREASFRNIKSIAECLADELINAARGSSNSYAIKKKDELERVAKSNR 210          
BLAST of FC921764 vs. ExPASy Swiss-Prot
Match: RS5_MOUSE (40S ribosomal protein S5 OS=Mus musculus GN=Rps5 PE=2 SV=3)

HSP 1 Score: 102.064 bits (253), Expect = 9.530e-22
Identity = 55/70 (78.57%), Postives = 61/70 (87.14%), Query Frame = 1
Query:    7 RRQAVHVSPLRRVP*NLSLLTIGAREASFRNIKSIAECPAEELINAAKSSSHSYAIKKKDELERVAQSNR 216
            RRQAV VSPLRRV   + LL  GAREA+FRNIK+IAEC A+ELINAAK SS+SYAIKKKDELERVA+SNR
Sbjct:  135 RRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKNIAECLADELINAAKGSSNSYAIKKKDELERVAKSNR 204          
BLAST of FC921764 vs. ExPASy Swiss-Prot
Match: RS5_HUMAN (40S ribosomal protein S5 OS=Homo sapiens GN=RPS5 PE=1 SV=4)

HSP 1 Score: 102.064 bits (253), Expect = 9.530e-22
Identity = 55/70 (78.57%), Postives = 61/70 (87.14%), Query Frame = 1
Query:    7 RRQAVHVSPLRRVP*NLSLLTIGAREASFRNIKSIAECPAEELINAAKSSSHSYAIKKKDELERVAQSNR 216
            RRQAV VSPLRRV   + LL  GAREA+FRNIK+IAEC A+ELINAAK SS+SYAIKKKDELERVA+SNR
Sbjct:  135 RRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDELERVAKSNR 204          
BLAST of FC921764 vs. ExPASy Swiss-Prot
Match: RS5_BOVIN (40S ribosomal protein S5 OS=Bos taurus GN=RPS5 PE=2 SV=3)

HSP 1 Score: 102.064 bits (253), Expect = 9.530e-22
Identity = 55/70 (78.57%), Postives = 61/70 (87.14%), Query Frame = 1
Query:    7 RRQAVHVSPLRRVP*NLSLLTIGAREASFRNIKSIAECPAEELINAAKSSSHSYAIKKKDELERVAQSNR 216
            RRQAV VSPLRRV   + LL  GAREA+FRNIK+IAEC A+ELINAAK SS+SYAIKKKDELERVA+SNR
Sbjct:  135 RRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDELERVAKSNR 204          
The following BLAST results are available for this feature:
BLAST of FC921764 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
RS5_NEUCR7.796e-2482.8640S ribosomal protein S5 OS=Neurospora crassa GN=r... [more]
RS5B_SCHPO1.737e-2380.0040S ribosomal protein S5-B OS=Schizosaccharomyces ... [more]
RS5A_SCHPO1.737e-2380.0040S ribosomal protein S5-A OS=Schizosaccharomyces ... [more]
RS5_YEAST2.508e-2281.4340S ribosomal protein S5 OS=Saccharomyces cerevisi... [more]
RS5_CICAR3.275e-2277.1440S ribosomal protein S5 (Fragment) OS=Cicer ariet... [more]
RS51_ARATH7.297e-2275.7140S ribosomal protein S5-1 OS=Arabidopsis thaliana... [more]
RS5_PODCA9.530e-2278.5740S ribosomal protein S5 OS=Podocoryne carnea GN=R... [more]
RS5_MOUSE9.530e-2278.5740S ribosomal protein S5 OS=Mus musculus GN=Rps5 P... [more]
RS5_HUMAN9.530e-2278.5740S ribosomal protein S5 OS=Homo sapiens GN=RPS5 P... [more]
RS5_BOVIN9.530e-2278.5740S ribosomal protein S5 OS=Bos taurus GN=RPS5 PE=... [more]

Pages

back to top
Libraries
Library NameType
RindPdigScdna_library
Properties
Property NameValue
Genbank descriptionC06052A12T7 RindPdigS Citrus sinensis cDNA clone C06052A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC921764 ID=FC921764|Name=FC921764|organism=Citrus sinensis|type=EST|length=324bp
CCGCCCCGTCGTCAAGCCGTCCATGTGTCTCCCCTCCGTCGCGTGCCCTA
GAACCTCTCTCTGCTCACCATCGGTGCCCGCGAGGCTTCTTTCCGCAACA
TCAAGAGCATTGCTGAGTGCCCTGCTGAGGAGCTGATCAACGCCGCCAAG
AGTTCCTCCCACTCCTACGCTATCAAGAAGAAGGATGAGCTCGAGCGTGT
TGCCCAGAGCAACCGGTAAAGGGGTTGTGTTGGATTTGTTCTCCCTATGG
TCCTCTGTTTGCGTATACTGGAGTGGACGGGGGTTTAACCCGGATTCAGT
GGATTCGCATGCATCTGCCAGGCT
back to top