FC921759

Overview
NameFC921759
Unique NameFC921759
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length269
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10524 contig Csv1_Contig10524:565..833. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC921759 vs. ExPASy Swiss-Prot
Match: HEMH_CUCSA (Ferrochelatase-2, chloroplastic OS=Cucumis sativus GN=HEMH PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 2.032e-40
Identity = 79/88 (89.77%), Postives = 83/88 (94.32%), Query Frame = 1
Query:    4 VSYVEKAGDPYRDQMEECIYLIMQRLKDRGINNDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAIPVSFVSEHIETLEEIDM 267
            VSYVE AGDPY+DQMEECI LIMQ LK RGI N+HTLAYQSRVGPVQWLKPYTDEVLVELGQKG+KSLLA+PVSFVSEHIETLEEIDM
Sbjct:  313 VSYVENAGDPYKDQMEECICLIMQELKARGIGNEHTLAYQSRVGPVQWLKPYTDEVLVELGQKGIKSLLAVPVSFVSEHIETLEEIDM 400          
BLAST of FC921759 vs. ExPASy Swiss-Prot
Match: HEMH_HORVU (Ferrochelatase-2, chloroplastic OS=Hordeum vulgare GN=HEMH PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 1.115e-38
Identity = 76/88 (86.36%), Postives = 82/88 (93.18%), Query Frame = 1
Query:    4 VSYVEKAGDPYRDQMEECIYLIMQRLKDRGINNDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAIPVSFVSEHIETLEEIDM 267
            ++YV+ AGDPYRDQME+CI LIM+ LK RG  NDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLA+PVSFVSEHIETLEEIDM
Sbjct:  307 LTYVKDAGDPYRDQMEDCIALIMEELKSRGTLNDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAVPVSFVSEHIETLEEIDM 394          
BLAST of FC921759 vs. ExPASy Swiss-Prot
Match: HEMH1_ORYSJ (Ferrochelatase-1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os09g0297000 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 2.103e-37
Identity = 75/88 (85.23%), Postives = 80/88 (90.91%), Query Frame = 1
Query:    4 VSYVEKAGDPYRDQMEECIYLIMQRLKDRGINNDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAIPVSFVSEHIETLEEIDM 267
            ++YV  AGDPYRDQME+CI LIM  LK RGI N HTLAYQSRVGPVQWLKPYTDEVLVELGQ+GVKSLLA+PVSFVSEHIETLEEIDM
Sbjct:  305 LTYVTDAGDPYRDQMEDCIALIMGELKSRGILNSHTLAYQSRVGPVQWLKPYTDEVLVELGQQGVKSLLAVPVSFVSEHIETLEEIDM 392          
BLAST of FC921759 vs. ExPASy Swiss-Prot
Match: HEMH1_ARATH (Ferrochelatase-1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=HEM15 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 4.685e-37
Identity = 74/88 (84.09%), Postives = 80/88 (90.91%), Query Frame = 1
Query:    4 VSYVEKAGDPYRDQMEECIYLIMQRLKDRGINNDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAIPVSFVSEHIETLEEIDM 267
            VSYVE AGDPY+ QMEECI LIM+ LK RG+ NDH LAYQSRVGPVQWLKPYTDEVLV+LG+ GVKSLLA+PVSFVSEHIETLEEIDM
Sbjct:  288 VSYVENAGDPYQKQMEECIDLIMEELKARGVLNDHKLAYQSRVGPVQWLKPYTDEVLVDLGKSGVKSLLAVPVSFVSEHIETLEEIDM 375          
BLAST of FC921759 vs. ExPASy Swiss-Prot
Match: HEMH_ORYSI (Ferrochelatase-2, chloroplastic OS=Oryza sativa subsp. indica GN=HEMH PE=2 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 3.712e-34
Identity = 65/88 (73.86%), Postives = 80/88 (90.91%), Query Frame = 1
Query:    4 VSYVEKAGDPYRDQMEECIYLIMQRLKDRGINNDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAIPVSFVSEHIETLEEIDM 267
            ++YVE+AGDPY+ +MEEC+ LIM+ L+ RGI N  TLAYQSRVGPV+WL+PYTDE ++ELGQKGVKSLLA+P+SFVSEHIETLEEID+
Sbjct:  312 LAYVEEAGDPYKAEMEECVDLIMEELEKRGITNSCTLAYQSRVGPVEWLRPYTDETIIELGQKGVKSLLAVPISFVSEHIETLEEIDV 399          
BLAST of FC921759 vs. ExPASy Swiss-Prot
Match: HEMH2_ORYSJ (Ferrochelatase-2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0361200 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 3.712e-34
Identity = 65/88 (73.86%), Postives = 80/88 (90.91%), Query Frame = 1
Query:    4 VSYVEKAGDPYRDQMEECIYLIMQRLKDRGINNDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAIPVSFVSEHIETLEEIDM 267
            ++YVE+AGDPY+ +MEEC+ LIM+ L+ RGI N  TLAYQSRVGPV+WL+PYTDE ++ELGQKGVKSLLA+P+SFVSEHIETLEEID+
Sbjct:  312 LAYVEEAGDPYKAEMEECVDLIMEELEKRGITNSCTLAYQSRVGPVEWLRPYTDETIIELGQKGVKSLLAVPISFVSEHIETLEEIDV 399          
BLAST of FC921759 vs. ExPASy Swiss-Prot
Match: HEMH2_ARATH (Ferrochelatase-2, chloroplastic OS=Arabidopsis thaliana GN=At2g30390 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.320e-31
Identity = 61/88 (69.32%), Postives = 78/88 (88.64%), Query Frame = 1
Query:    4 VSYVEKAGDPYRDQMEECIYLIMQRLKDRGINNDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAIPVSFVSEHIETLEEIDM 267
            ++YVE+AGDPY+ +MEEC+ LIM+ L  R I N +TLAYQSRVGPV+WLKPYT+E + ELG+KGV++LLA+P+SFVSEHIETLEEID+
Sbjct:  299 LAYVEEAGDPYKAEMEECVDLIMEELDKRKITNAYTLAYQSRVGPVEWLKPYTEEAITELGKKGVENLLAVPISFVSEHIETLEEIDV 386          
BLAST of FC921759 vs. ExPASy Swiss-Prot
Match: HEMH_SYNP2 (Ferrochelatase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=hemH PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 6.781e-28
Identity = 58/87 (66.67%), Postives = 74/87 (85.06%), Query Frame = 1
Query:    7 SYVEKAGDPYRDQMEECIYLIMQRLKDRGINNDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAIPVSFVSEHIETLEEIDM 267
            SYVE+AGDPY+ ++EEC  LIM+ L   G  ND+TLAYQSRVGPV+WL+PYT++ L+ LG+KGVK L+ IP+SFVSEHIETL+EID+
Sbjct:  201 SYVEEAGDPYQREIEECTKLIMEAL---GRPNDYTLAYQSRVGPVEWLQPYTEDSLIALGEKGVKDLVVIPISFVSEHIETLQEIDI 284          
BLAST of FC921759 vs. ExPASy Swiss-Prot
Match: HEMH_PROMA (Ferrochelatase OS=Prochlorococcus marinus GN=hemH PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 6.781e-28
Identity = 55/88 (62.50%), Postives = 74/88 (84.09%), Query Frame = 1
Query:    7 SYVEKAGDPYRDQMEECIYLIMQRL-KDRGINNDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAIPVSFVSEHIETLEEIDM 267
            SYVE+AGDPY+D++++C  LI+ ++ K  G +N +TL+YQSRVGP +WLKPYT+EVL ELG  GVK L+ +P+SFVSEHIETL+EID+
Sbjct:  201 SYVEEAGDPYKDEIQDCALLIIDKVEKSLGFSNSYTLSYQSRVGPEEWLKPYTEEVLEELGANGVKELIVVPISFVSEHIETLQEIDI 288          
BLAST of FC921759 vs. ExPASy Swiss-Prot
Match: HEMH_SYNR3 (Ferrochelatase OS=Synechococcus sp. (strain RCC307) GN=hemH PE=3 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.577e-27
Identity = 58/87 (66.67%), Postives = 72/87 (82.76%), Query Frame = 1
Query:    7 SYVEKAGDPYRDQMEECIYLIMQRLKDRGINNDHTLAYQSRVGPVQWLKPYTDEVLVELGQKGVKSLLAIPVSFVSEHIETLEEIDM 267
            SYVE+AGDPY+ ++E C  LIM+ L   G +N  TLAYQSRVGPV+WL+PYT+E L ELG+KGVK L+ +P+SFVSEHIETLEEID+
Sbjct:  201 SYVEEAGDPYQKEIESCAELIMKTL---GRDNPWTLAYQSRVGPVEWLQPYTEEALEELGEKGVKELVVVPISFVSEHIETLEEIDI 284          
The following BLAST results are available for this feature:
BLAST of FC921759 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 94
Match NameE-valueIdentityDescription
HEMH_CUCSA2.032e-4089.77Ferrochelatase-2, chloroplastic OS=Cucumis sativus... [more]
HEMH_HORVU1.115e-3886.36Ferrochelatase-2, chloroplastic OS=Hordeum vulgare... [more]
HEMH1_ORYSJ2.103e-3785.23Ferrochelatase-1, chloroplastic OS=Oryza sativa su... [more]
HEMH1_ARATH4.685e-3784.09Ferrochelatase-1, chloroplastic/mitochondrial OS=A... [more]
HEMH_ORYSI3.712e-3473.86Ferrochelatase-2, chloroplastic OS=Oryza sativa su... [more]
HEMH2_ORYSJ3.712e-3473.86Ferrochelatase-2, chloroplastic OS=Oryza sativa su... [more]
HEMH2_ARATH1.320e-3169.32Ferrochelatase-2, chloroplastic OS=Arabidopsis tha... [more]
HEMH_SYNP26.781e-2866.67Ferrochelatase OS=Synechococcus sp. (strain ATCC 2... [more]
HEMH_PROMA6.781e-2862.50Ferrochelatase OS=Prochlorococcus marinus GN=hemH ... [more]
HEMH_SYNR32.577e-2766.67Ferrochelatase OS=Synechococcus sp. (strain RCC307... [more]

Pages

back to top
Libraries
Library NameType
RindPdigScdna_library
Properties
Property NameValue
Genbank descriptionC06052A06T7 RindPdigS Citrus sinensis cDNA clone C06052A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC921759 ID=FC921759|Name=FC921759|organism=Citrus sinensis|type=EST|length=269bp
CTTGTCAGTTATGTTGAGAAAGCTGGTGATCCATACAGAGATCAGATGGA
GGAGTGTATCTACCTAATCATGCAGAGGTTGAAAGATAGAGGAATCAACA
ATGATCATACTTTGGCATACCAGAGTCGAGTTGGGCCTGTACAATGGCTG
AAGCCTTACACTGATGAAGTTCTTGTGGAGCTTGGCCAGAAAGGTGTCAA
GAGTCTTCTAGCCATTCCAGTCAGTTTTGTGAGCGAGCACATTGAAACTC
TTGAAGAGATTGACATGGA
back to top