CN186183

Overview
NameCN186183
Unique NameCN186183
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length720
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN186183_ssr121 microsatellite CN186183_ssr121:121..138. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig6849 contig Csv1_Contig6849:291..1009. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186183 vs. ExPASy Swiss-Prot
Match: HSP17_ARATH (17.4 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.4A PE=1 SV=2)

HSP 1 Score: 216.853 bits (551), Expect = 9.013e-56
Identity = 105/158 (66.46%), Postives = 126/158 (79.75%), Query Frame = -1
Query:  214 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 687
            MSL+PS FGGRRTNVFDPFSLDVWDPF+GFL+  LTNAP  A++ + F NA++DW+ETP+AHVFKAD+PGL+         +G ILQISGERS E EEK+D WHRVERSSGKF+RRFRLP+NAKVE+VKASMENGVL+VT           K+++ISG
Sbjct:    1 MSLVPSFFGGRRTNVFDPFSLDVWDPFEGFLTPGLTNAP--AKDVAAFTNAKVDWRETPEAHVFKADVPGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKASMENGVLSVTVPKVQESKPEVKSVDISG 156          
BLAST of CN186183 vs. ExPASy Swiss-Prot
Match: HS181_ARATH (18.1 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 9.965e-55
Identity = 108/160 (67.50%), Postives = 127/160 (79.38%), Query Frame = -1
Query:  214 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFL--SSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 687
            MSLIPSIFGGRR+NVFDPFS D+WDPF+GF   SSAL NA S+AR+ + F NAR+DWKETP+AHVFKADLPGL+         +  +LQISGERSKE EEKNDKWHRVER+SGKF+RRFRLP+NAK+E+VKA+MENGVLTV            K+I+ISG
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSQDLWDPFEGFFTPSSALANA-STARDVAAFTNARVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNVLQISGERSKENEEKNDKWHRVERASGKFMRRFRLPENAKMEEVKATMENGVLTVVVPKAPEKKPQVKSIDISG 159          
BLAST of CN186183 vs. ExPASy Swiss-Prot
Match: HS17C_ARATH (17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2)

HSP 1 Score: 213.386 bits (542), Expect = 9.965e-55
Identity = 109/159 (68.55%), Postives = 126/159 (79.25%), Query Frame = -1
Query:  214 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLS-SALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 687
            MSLIPSIFGGRRTNVFDPFSLDV+DPF+GFL+ S L NAP  A + + F NA++DW+ETP+AHVFKADLPGLR         +G ILQISGERS E EEKNDKWHRVERSSGKF RRFRLP+NAK+E++KASMENGVL+VT           K+I+ISG
Sbjct:    1 MSLIPSIFGGRRTNVFDPFSLDVFDPFEGFLTPSGLANAP--AMDVAAFTNAKVDWRETPEAHVFKADLPGLRKEEVKVEVEDGNILQISGERSNENEEKNDKWHRVERSSGKFTRRFRLPENAKMEEIKASMENGVLSVTVPKVPEKKPEVKSIDISG 157          
BLAST of CN186183 vs. ExPASy Swiss-Prot
Match: HSP11_DAUCA (17.8 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.218e-52
Identity = 104/158 (65.82%), Postives = 121/158 (76.58%), Query Frame = -1
Query:  214 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 687
            MS+IPS FGGRR+NVFDPFSLDVWDPF  F     ++A    +ET+ F N  IDWKETPQAHVFKADLPGL+         EG++LQISGER+KE+EEKNDKWHRVERSSGKFLRRFRLP+NAKV++VKA+M NGV+TVT           KAI+ISG
Sbjct:    1 MSIIPSFFGGRRSNVFDPFSLDVWDPFKDF-PLVTSSASEFGKETAAFVNTHIDWKETPQAHVFKADLPGLKKEEVKVELEEGKVLQISGERNKEKEEKNDKWHRVERSSGKFLRRFRLPENAKVDEVKAAMANGVVTVTVPKVEIKKPEVKAIDISG 157          
BLAST of CN186183 vs. ExPASy Swiss-Prot
Match: HSP16_SOYBN (18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 6.046e-52
Identity = 106/163 (65.03%), Postives = 122/163 (74.85%), Query Frame = -1
Query:  214 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGF-----LSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 687
            MSLIP+ FGGRR NVFDPFSLDVWDPF  F     LSSA  + P  +RE S F + R+DWKETP+AHVFKAD+PGL+         + ++LQISGER+ E+E+KND WHRVERSSGKF+RRFRLP+NAKVEQVKASMENGVLTVT           KAIEISG
Sbjct:    1 MSLIPNFFGGRRNNVFDPFSLDVWDPFKDFPFPNTLSSA--SFPEFSRENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDKVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 161          
BLAST of CN186183 vs. ExPASy Swiss-Prot
Match: HSP13_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-M PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.118e-51
Identity = 104/159 (65.41%), Postives = 120/159 (75.47%), Query Frame = -1
Query:  214 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 687
            MSLIPSIFGGRR+NVFDPFSLDVWDPF  F      + P+S + E S F N R+DWKETP+AHVF+AD+PGL+         + R+LQISGER+ E+E+KND WHRVERSSG F+RRFRLP+NAKVEQVKASMENGVLTVT           KAIEISG
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSLDVWDPFKDF------HFPTSLSAENSAFVNTRVDWKETPEAHVFEADIPGLKKEEVKVQIEDDRVLQISGERNLEKEDKNDTWHRVERSSGNFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 153          
BLAST of CN186183 vs. ExPASy Swiss-Prot
Match: HSP12_MEDSA (18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 6.684e-51
Identity = 99/158 (62.66%), Postives = 119/158 (75.32%), Query Frame = -1
Query:  214 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 687
            MSLIPS FGGRR+NVFDPFSLDVWDPF  F  +    + S  RE S F + R+DWKETP+AHVFKADLPG++         + R+LQISGERS E+E+KND+WHR+ERSSGKF+RRFRLP+NAK++QVKA+MENGVLTVT           K I+ISG
Sbjct:    1 MSLIPSFFGGRRSNVFDPFSLDVWDPFKDFPFNNSALSASFPRENSAFVSTRVDWKETPEAHVFKADLPGMKKEEVKVEIEDDRVLQISGERSVEKEDKNDQWHRLERSSGKFMRRFRLPENAKMDQVKAAMENGVLTVTVPKEEVKKPEVKTIDISG 158          
BLAST of CN186183 vs. ExPASy Swiss-Prot
Match: HSP11_PEA (18.1 kDa class I heat shock protein OS=Pisum sativum GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.140e-50
Identity = 101/158 (63.92%), Postives = 118/158 (74.68%), Query Frame = -1
Query:  214 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 687
            MSLIPS F GRR+NVFDPFSLDVWDP   F  S  + + S  RE   F + R+DWKETP+AHVFKADLPGL+         + R+LQISGERS E+E+KND+WHRVERSSGKFLRRFRLP+NAK+++VKASMENGVLTVT           K+IEISG
Sbjct:    1 MSLIPSFFSGRRSNVFDPFSLDVWDPLKDFPFSNSSPSASFPRENPAFVSTRVDWKETPEAHVFKADLPGLKKEEVKVEVEDDRVLQISGERSVEKEDKNDEWHRVERSSGKFLRRFRLPENAKMDKVKASMENGVLTVTVPKEEIKKAEVKSIEISG 158          
BLAST of CN186183 vs. ExPASy Swiss-Prot
Match: HSP11_SOYBN (17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.652e-50
Identity = 102/159 (64.15%), Postives = 119/159 (74.84%), Query Frame = -1
Query:  214 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 687
            MSLIPS FGGRR++VFDPFSLDVWDPF  F        PSS + E S F + R+DWKETP+AHVFKAD+PGL+         +GR+LQISGER+ E+E+KND WHRVERSSGK +RRFRLP+NAKV+QVKASMENGVLTVT           KAI+ISG
Sbjct:    1 MSLIPSFFGGRRSSVFDPFSLDVWDPFKDF------PFPSSLSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKLEIQDGRVLQISGERNVEKEDKNDTWHRVERSSGKLVRRFRLPENAKVDQVKASMENGVLTVTVPKEEIKKPDVKAIDISG 153          
BLAST of CN186183 vs. ExPASy Swiss-Prot
Match: HSP14_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-E PE=3 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 4.790e-49
Identity = 100/160 (62.50%), Postives = 117/160 (73.12%), Query Frame = -1
Query:  214 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSA--RETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXEGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXKAIEISG 687
            MSLIP  FGGRR+NVFDPFSLD+WDPF  F      + P+S+   E S F + R+DWKETP+AHVFKAD+PGL+         + R+LQISGER+ E+E+KND WHRVERSSGKF RRFRLP+NAKV +VKASMENGVLTVT           KAIEISG
Sbjct:    1 MSLIPGFFGGRRSNVFDPFSLDMWDPFKDF------HVPTSSVSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFTRRFRLPENAKVNEVKASMENGVLTVTVPKEEVKKPDVKAIEISG 154          
The following BLAST results are available for this feature:
BLAST of CN186183 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HSP17_ARATH9.013e-5666.4617.4 kDa class I heat shock protein OS=Arabidopsis... [more]
HS181_ARATH9.965e-5567.5018.1 kDa class I heat shock protein OS=Arabidopsis... [more]
HS17C_ARATH9.965e-5568.5517.6 kDa class I heat shock protein 3 OS=Arabidops... [more]
HSP11_DAUCA1.218e-5265.8217.8 kDa class I heat shock protein OS=Daucus caro... [more]
HSP16_SOYBN6.046e-5265.0318.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP13_SOYBN5.118e-5165.4117.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP12_MEDSA6.684e-5162.6618.2 kDa class I heat shock protein OS=Medicago sa... [more]
HSP11_PEA1.140e-5063.9218.1 kDa class I heat shock protein OS=Pisum sativ... [more]
HSP11_SOYBN9.652e-5064.1517.3 kDa class I heat shock protein OS=Glycine max... [more]
HSP14_SOYBN4.790e-4962.5017.5 kDa class I heat shock protein OS=Glycine max... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002H24_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002H24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186183 ID=CN186183|Name=CN186183|organism=Citrus sinensis|type=EST|length=720bp
TGCATCCACTTTTACATTTAAAAAACTAGTCCCCTATAGGGAGACTGGCT
CCTGAAGCTCTTGCAAACACACCCCTTTAATCACATCAAATTAAACAGGG
GGGAAGGGAAGCTCTTGCAAACACACACACACACACACAAGGGCTTTGCT
TTCGTACCAAATTTATTAGCAAACCAAAGACACAATCTTGAAAACATTTA
CACTTATCACTTAGCCAGAGATCTCAATGGCCTTAACTTCAGGTTTCTTC
TCCTCCTGTTTAGGAACAGTCACTGTGAGCACACCATTCTCCATGCTGGC
CTTAACCTGCTCCACCTTAGCATTGTCGGGCAACCTGAACCTCCTCAGGA
ACTTGCCACTGCTCCTCTCGACGCGATGCCACTTGTCATTCTTCTCTTCC
TGCTCCTTGCTCCTCTCCCCGCTTATCTGCAGAATCCTGCCCTCTTCAAC
CTCAACTTTCACTTCTTCTTTCCTCAGCCCTGGAAGATCAGCCTTGAATA
CATGAGCCTGAGGAGTCTCTTTCCAGTCAATTCTTGCATTGGCGAATTGG
GATGTTTCCCTAGCCGAAGACGGCGCGTTGGTAAGGGCAGAGGACAAGAA
CCCGTCGAAAGGATCCCATACATCTAATGAAAATGGATCGAACACGTTGG
TTCTTCGGCCACCGAATATGCTTGGAATGAGTGACATTATGGCAAACTGG
GGCGCTAATTAAATGCTCAA
back to top