CN186181

Overview
NameCN186181
Unique NameCN186181
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length757
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4023 contig Csv1_Contig4023:108..863. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186181 vs. ExPASy Swiss-Prot
Match: RL131_ARATH (60S ribosomal protein L13-1 OS=Arabidopsis thaliana GN=RPL13B PE=1 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 1.620e-74
Identity = 136/177 (76.84%), Postives = 151/177 (85.31%), Query Frame = -1
Query:  227 QNYVKTWFNQPXXXXXXXXXXXXXXXKIFPRPTAGPLRPVVHGQTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELVKVTQDMKSFKAYDKLRIERVNERHFGAR 757
            QNYVKTWFNQP               KIFPRPT+GPLRPVVHGQTLKYNMK+R G+GFTLEELKAAGIPKKLAPTIG++VDHRRKNRSLEGLQ+NVQRLKTYK KLV+FPRRARK KAGDS PEELA ATQVQG Y+PI  EKPT+ELVK+T +MKSFKA+DK+R+ER N+RH GAR
Sbjct:   17 QNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKTKLVIFPRRARKVKAGDSTPEELANATQVQGDYLPIVREKPTMELVKLTSEMKSFKAFDKIRLERTNKRHAGAR 193          
BLAST of CN186181 vs. ExPASy Swiss-Prot
Match: RL133_ARATH (60S ribosomal protein L13-3 OS=Arabidopsis thaliana GN=RPL13D PE=2 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.791e-73
Identity = 137/177 (77.40%), Postives = 149/177 (84.18%), Query Frame = -1
Query:  227 QNYVKTWFNQPXXXXXXXXXXXXXXXKIFPRPTAGPLRPVVHGQTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELVKVTQDMKSFKAYDKLRIERVNERHFGAR 757
            QNYVKTWFNQP               KIFPRPT+GPLRPVVHGQTLKYNMK+RAG+GFTLEELK AGIPKKLAPTIG+SVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRR+R+ KAGDS PEELA ATQVQG YMPIA  K  +ELVK+T D+K+FKAYDK+R+ER N RH GAR
Sbjct:   17 QNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRAGKGFTLEELKVAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRSRQVKAGDSTPEELANATQVQGDYMPIASVKAAMELVKLTADLKAFKAYDKIRLERTNARHAGAR 193          
BLAST of CN186181 vs. ExPASy Swiss-Prot
Match: RL132_BRANA (60S ribosomal protein L13-2 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 1.161e-72
Identity = 136/177 (76.84%), Postives = 147/177 (83.05%), Query Frame = -1
Query:  227 QNYVKTWFNQPXXXXXXXXXXXXXXXKIFPRPTAGPLRPVVHGQTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELVKVTQDMKSFKAYDKLRIERVNERHFGAR 757
            QNYVKTWFNQP               KIFPRPTAGPLRPVVHGQTLKYNMK+R G+GFTLEELKAAGIPKKLAPTIG+S+DHRRKNRSLEGLQSNVQRLKTYKAKLV+FPRRARK KAGDS  EELA ATQVQG YMPI  EK  +ELVK+T +MKS  AYDK+R+ER N+RH GAR
Sbjct:   17 QNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISLDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKQAMELVKLTSEMKSVNAYDKIRLERTNKRHAGAR 193          
BLAST of CN186181 vs. ExPASy Swiss-Prot
Match: RL131_BRANA (60S ribosomal protein L13-1 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 4.411e-72
Identity = 135/177 (76.27%), Postives = 147/177 (83.05%), Query Frame = -1
Query:  227 QNYVKTWFNQPXXXXXXXXXXXXXXXKIFPRPTAGPLRPVVHGQTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELVKVTQDMKSFKAYDKLRIERVNERHFGAR 757
            QNYVKTWFNQP               KIFPRPTAGPLRPVVHGQTLKYNMK+R G+GFTLEELK+AGIPKKLAPTIG++VDHRRKNRSLEGLQSNVQRLKTYKAKLV+FPRRARK KAGDS  EELA ATQVQG YMPI  EK   ELVK+T +MKS KA+DK+R+ER N+RH GAR
Sbjct:   17 QNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRTGKGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKHATELVKLTTEMKSVKAFDKIRLERTNKRHAGAR 193          
BLAST of CN186181 vs. ExPASy Swiss-Prot
Match: RL132_ARATH (Putative 60S ribosomal protein L13-2 OS=Arabidopsis thaliana GN=RPL13C PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 2.344e-65
Identity = 125/177 (70.62%), Postives = 140/177 (79.10%), Query Frame = -1
Query:  227 QNYVKTWFNQPXXXXXXXXXXXXXXXKIFPRPTAGPLRPVVHGQTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELVKVTQDMKSFKAYDKLRIERVNERHFGAR 757
            +NYVKT FNQP               KIFPRPTAGP+RPVVH QTL YNMK+RAG+GFTLEELKAAGIPKKLAPTIG+SVDH RKNRSLEG Q+NVQRLKTYKAKLV+FPR AR  K GDSA +ELA ATQVQ  +MPI  E PT+ELVK+T DMK F AYDK+R+E +N+RH G R
Sbjct:   17 ENYVKTSFNQPAMKTRRRIARQNKAVKIFPRPTAGPIRPVVHAQTLTYNMKVRAGKGFTLEELKAAGIPKKLAPTIGISVDHHRKNRSLEGFQTNVQRLKTYKAKLVIFPRCARTVKVGDSAQQELANATQVQVDHMPIVREMPTMELVKLTSDMKLFNAYDKIRLEGINKRHAGVR 193          
BLAST of CN186181 vs. ExPASy Swiss-Prot
Match: RL13_TOBAC (60S ribosomal protein L13 OS=Nicotiana tabacum GN=RPL13 PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 3.279e-59
Identity = 117/178 (65.73%), Postives = 133/178 (74.72%), Query Frame = -1
Query:  224 QNYVKTWFNQPXXXXXXXXXXXXXXXKIFPRPTAGPLRPVVHGQTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELVKVTQDMKSFKAYDKLRIERVNERHFGARM 757
            QNYVKTWFNQP               KI PRPTAG LRP+VHGQTLKYNMK+R+GRGF+LEELKAAGIPKKLAPTIG++VDHRR+NRSLEGLQ+NVQRL+  + +LVVFPRRA + +     P    TATQV G YMPI  EK  + L KV + MKSF AY KLR+ER NERH GARM
Sbjct:   13 QNYVKTWFNQPARKTRRRIARQKKAVKISPRPTAGTLRPIVHGQTLKYNMKVRSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLEDLQGQLVVFPRRASRSRLVILPPRNCLTATQVHGAYMPIEREKHQLILSKVLKKMKSFNAYAKLRVERTNERHIGARM 190          
BLAST of CN186181 vs. ExPASy Swiss-Prot
Match: RL13_CHLSW (60S ribosomal protein L13 OS=Chlamydomonas sp. (strain W80) GN=RPL13 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.633e-50
Identity = 100/177 (56.50%), Postives = 122/177 (68.93%), Query Frame = -1
Query:  227 QNYVKTWFNQPXXXXXXXXXXXXXXXKIFPRPTAGPLRPVVHGQTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELVKVTQDMKSFKAYDKLRIERVNERHFGAR 757
            Q +VKTWFNQP                 FPRP AG L+P+V  QT+KYN K R GRGFTLEELK AGIP K APT+G++VDHRRKNRSLE LQ+NVQRLKTY+A LV+FPR  +K KA +++  + + A+Q +G  +P+   KP +ELVK+T DMK    Y KLRIERVN R  G R
Sbjct:   18 QFHVKTWFNQPARKQRRRNARAEKAKATFPRPVAGSLKPIVRCQTVKYNTKQRLGRGFTLEELKEAGIPAKFAPTVGIAVDHRRKNRSLETLQANVQRLKTYRASLVIFPRNMKKPKAFEASAADCSAASQAKGELLPLKGTKPALELVKITADMKEGSQYGKLRIERVNARLKGMR 194          
BLAST of CN186181 vs. ExPASy Swiss-Prot
Match: RL13_DANRE (60S ribosomal protein L13 OS=Danio rerio GN=rpl13 PE=2 SV=3)

HSP 1 Score: 187.578 bits (475), Expect = 6.413e-47
Identity = 97/177 (54.80%), Postives = 120/177 (67.80%), Query Frame = -1
Query:  227 QNYVKTWFNQPXXXXXXXXXXXXXXXKIFPRPTAGPLRPVVHGQTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELVKVTQDMKSFKAYDKLRIERVNERHFGAR 757
            Q  V+TWFNQP               +I PRP +GPLRPVV   T++Y+ K+RAGRGFTLEELKAAGI KK+A TIG+SVD RR+NRS E LQ+NVQRLK Y+ KL++FPR+A K K GDS  EEL  ATQ+ GP MPI       +   +++D K+FKA+  LR+ R N R FG R
Sbjct:   19 QKRVRTWFNQPARKIRRRKARQAKARRIAPRPVSGPLRPVVRCPTIRYHTKVRAGRGFTLEELKAAGINKKVARTIGISVDSRRRNRSTESLQANVQRLKEYRTKLIIFPRKAAKPKKGDSTEEELKMATQLTGPVMPIKKVHKKEKARVISEDEKNFKAFASLRMARANARLFGIR 195          
BLAST of CN186181 vs. ExPASy Swiss-Prot
Match: RL13_DROME (60S ribosomal protein L13 OS=Drosophila melanogaster GN=RpL13 PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.082e-44
Identity = 92/178 (51.69%), Postives = 118/178 (66.29%), Query Frame = -1
Query:  227 QNYVKTWFNQPXXXXXXXXXXXXXXXKIFPRPTAGPLRPVVHGQTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKP-TVELVKVTQDMKSFKAYDKLRIERVNERHFGAR 757
            Q +VKTWFNQP                +FPRP +G LRPVV   T++Y+ KLRAGRGFTLEELK AGI    A TIG++VD RRKN+SLE  Q N+QRLK Y++KL++FP   +K +AG+S+ EE   ATQ++GP +PI  E+P  VE  +VT+D K FKA+  LR  R + R  G R
Sbjct:   18 QRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIRAGESSLEECKLATQLKGPVLPIKNEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVGIR 195          
BLAST of CN186181 vs. ExPASy Swiss-Prot
Match: RL13_ICTPU (60S ribosomal protein L13 OS=Ictalurus punctatus GN=rpl13 PE=2 SV=3)

HSP 1 Score: 176.407 bits (446), Expect = 1.478e-43
Identity = 91/177 (51.41%), Postives = 115/177 (64.97%), Query Frame = -1
Query:  227 QNYVKTWFNQPXXXXXXXXXXXXXXXKIFPRPTAGPLRPVVHGQTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELVKVTQDMKSFKAYDKLRIERVNERHFGAR 757
            Q  V+TWFNQP               +I PRP AGPLRP+V   T++YN K+RAGRGFTLEELKAAGI K++A TIG++VD RR+NRS E L  NVQRLK Y++KL++FPR+    K GDS  EE+  ATQ+ GP MPI       +   +T++ K F A+  LR+ R N R FG R
Sbjct:   19 QKRVRTWFNQPARKLRRRKARQAKARRIAPRPVAGPLRPIVRCPTVRYNTKVRAGRGFTLEELKAAGINKRVARTIGIAVDPRRRNRSTESLHVNVQRLKVYRSKLILFPRKVSAPKKGDSTEEEVKMATQLTGPVMPIKIVHKKEKARMITEEEKKFNAFANLRMARANARLFGIR 195          
The following BLAST results are available for this feature:
BLAST of CN186181 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
RL131_ARATH1.620e-7476.8460S ribosomal protein L13-1 OS=Arabidopsis thalian... [more]
RL133_ARATH1.791e-7377.4060S ribosomal protein L13-3 OS=Arabidopsis thalian... [more]
RL132_BRANA1.161e-7276.8460S ribosomal protein L13-2 OS=Brassica napus PE=2... [more]
RL131_BRANA4.411e-7276.2760S ribosomal protein L13-1 OS=Brassica napus PE=2... [more]
RL132_ARATH2.344e-6570.62Putative 60S ribosomal protein L13-2 OS=Arabidopsi... [more]
RL13_TOBAC3.279e-5965.7360S ribosomal protein L13 OS=Nicotiana tabacum GN=... [more]
RL13_CHLSW3.633e-5056.5060S ribosomal protein L13 OS=Chlamydomonas sp. (st... [more]
RL13_DANRE6.413e-4754.8060S ribosomal protein L13 OS=Danio rerio GN=rpl13 ... [more]
RL13_DROME5.082e-4451.6960S ribosomal protein L13 OS=Drosophila melanogast... [more]
RL13_ICTPU1.478e-4351.4160S ribosomal protein L13 OS=Ictalurus punctatus G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002H23_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002H23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186181 ID=CN186181|Name=CN186181|organism=Citrus sinensis|type=EST|length=757bp
TTTTTTTTTTTTTTTTTCAAACCAAAACAACATTGGATAGGCCCTTTGCA
AATAATATAACCAAGAAATCTTCCCACATTCAAAATAAAATAACAATTTC
AAGCCTAAAGCTAACAGATTGAAATCACTATAACAAAATGCCAAAAACAG
GCCCACATTCAAAGTGTTGCTTAAACAAGTTTTTTTACTTCTTCTCTTCC
TTTTCAGCCTCTGCAGCCTTCTTCATCCTGGCACCAAAATGGCGCTCGTT
CACACGCTCGATACGGAGTTTGTCATAAGCCTTGAAGGACTTCATATCTT
GAGTAACCTTAACAAGCTCGACAGTAGGCTTCTCAGGAGCAATGGGCATG
TAAGGTCCTTGTACTTGAGTTGCTGTTGCCAATTCCTCAGGGGCAGAATC
ACCAGCCTTGAACTTGCGAGCACGTCTTGGGAAAACAACCAACTTAGCCT
TGTAAGTCTTGAGCCTCTGAACATTAGATTGAAGACCCTCAAGAGAACGG
TTCTTGCGTCGATGATCGACTGAAACACCAATTGTCGGAGCCAGTTTCTT
GGGAATTCCAGCAGCCTTGAGTTCCTCAAGAGTAAAGCCTCTGCCAGCCC
TTAATTTCATGTTGTATTTCAAAGTCTGGCCATGAACGACGGGACGAAGC
GGCCCAGCAGTAGGGCGAGGGAAGATTTTAACGGCCTTCTTTTGACGAGC
GACTCGTCGTCGATTTTTGCGAGCAGGTTGGTTGAACCAAGTCTTGACAT
AGTTCTG
back to top