CN186173

Overview
NameCN186173
Unique NameCN186173
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length782
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN186173_ssr411 microsatellite CN186173_ssr411:411..422. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2527 contig Csv1_Contig2527:1..780. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186173 vs. ExPASy Swiss-Prot
Match: KEG_ARATH (E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 1.406e-28
Identity = 56/63 (88.89%), Postives = 60/63 (95.24%), Query Frame = -1
Query:  594 VGDKVRIKEGLVTPRWGWGMETHASKGQVVGVDANGKLRIKFQWREGRPWIGDPADIVLDECS 782
            +GD+V+IK+GLVTPRWGWGMETHASKG VVGVDANGKLRIKF WREGRPWIGDPADIVLDE S
Sbjct: 1562 IGDRVKIKDGLVTPRWGWGMETHASKGHVVGVDANGKLRIKFLWREGRPWIGDPADIVLDETS 1624          
The following BLAST results are available for this feature:
BLAST of CN186173 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
KEG_ARATH1.406e-2888.89E3 ubiquitin-protein ligase KEG OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002H19_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002H19, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186173 ID=CN186173|Name=CN186173|organism=Citrus sinensis|type=EST|length=782bp
TTTTTTTTTTTTTTTGATCAATCAGCTGCATATACATATAGCCGCTTTTA
TAAAAAATTTGGTCACATCAGGGCGAGGGCGATGTTTAGTTTACAATATA
TATTCACCATTTCTTTTCAGTCAAAGAATTGGAGAAAGTGTTGGGTAAGC
AGGAAGATAACACTGCTATAAAAGAACCCATTAAGTGAAAACTCACAAGA
TTAGTGTTCAATTTCTACAAAATACATATAAATGATCACATATATATACC
TCAAAAACTTACAACCTACAACCATCATCTATGAGATACAAATGGCCTAC
AGCTACTTTTTTTACCTGGCTGCTTTCGTATTTCCTATAATTAACAGTAA
GGCAAGCCAATTTCTCCATCATGTGCTCAGTTTCCATCTATCTGTATTTC
CATTTTATTGAAATAAATAAATTCGATCATCCCCACGATAACTTCGCATA
TTGTTTGGAGAGCAAACTCCAAATCTAACTGCGTGATGCAGTGGAATTCA
CAGCCCCACATCTGTTGGGAGAAGAAGCTTCTATAACAAACTGCAAGAAA
ATTTGATAGCAATCACAATTCACGAAGTGCCTGTTCTGCAAGATGAGCAC
TCGTCAAGCACAATATCAGCGGGATCTCCAATCCATGGTCTCCCTTCTCT
CCATTGAAATTTAATTCTTAACTTCCCGTTTGCATCTACACCAACCACTT
GCCCTTTGCTTGCATGAGTCTCCATTCCCCATCCCCATCGAGGAGTCACC
AACCCTTCTTTTATCCTCACTTTGTCCCCCAC
back to top