CV998080

Overview
NameCV998080
Unique NameCV998080
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length955
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CV998080_ssr939 microsatellite CV998080_ssr939:939..950. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13760 contig Csv1_Contig13760:29..985. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998080 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.290e-24
Identity = 69/186 (37.10%), Postives = 101/186 (54.30%), Query Frame = -3
Query:  429 MKTSFVVKLSFLILALATKAQ---LGTSESEPVLDVYGNKVESNLEYKLLEVKNGTSGGFSIHGGTSGE-CPLDVVQLSSPTERDHYVRLLPFDNST-VVRESTDLNL-----------IEPVWTVGNYNDSLGKWFLTTGGIIGHPGAKTLLNWFKLEKVSVSIYNLVHCPSVCDSCVKLCNKVG 938
            MKT+  V L  L+ A  +K+    +  + + PVLD  G+++++ ++Y +L   +G  GG    G  +G+ CP  VVQ  S  +    V     D+   VVR STD+N+              VW + NY++S GKW++TT G+ G PG  TL +WFK+EK  V  Y    CPSVCDSC  LC+ +G
Sbjct:    1 MKTATAVVL--LLFAFTSKSYFFGVANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVLGYKFRFCPSVCDSCTTLCSDIG 184          
BLAST of CV998080 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 105.531 bits (262), Expect = 4.586e-22
Identity = 67/194 (34.54%), Postives = 98/194 (50.52%), Query Frame = -3
Query:  423 MKTSFVVKLSFL----ILALATKAQLGTSES--EPVLDVYGNKVESNLEYKLLEVKNGTSGGFSIHGGTSGE---CPLDVVQLSSPTERDHYVRLLPFD-NSTVVRESTDLNL-----------IEPVWTVGNYNDSLGKWFLTTGGIIGHPGAKTLLNWFKLEKVSVS-IYNLVHCPSVCDSCVKLCNKVGIF 938
            MK   ++ LSF     +LA A    L  ++S   PVLD+ G K+ +   Y ++ V     GG ++   T      CP  VVQ     + D  +   P +    VVR STDLN+              VW +  Y++S G++F+T GG+ G+PG +T+ +WFK+E+   S  Y LV CP+VC SC   C  VGI+
Sbjct:    1 MKELTMLSLSFFFVSALLAAAANPLLSAADSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIY 194          
BLAST of CV998080 vs. ExPASy Swiss-Prot
Match: SPI5_SOLTU (Serine protease inhibitor 5 OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.115e-11
Identity = 54/172 (31.40%), Postives = 81/172 (47.09%), Query Frame = -3
Query:  420 SESEPVLDVYGNKVESNLEYKLLEVKNGTSGG--------------------FSIHGGTSGECPLDVVQLSS---PTERDHYVRLLPFDNSTVVRESTDLNLIEPVWTVGNYNDSLGKWFLTTGGIIGHPGAKTLLNWFKLEKVSVSIYNLVHCPSVCDSCVKLCNKVGIFY 866
            S++ PVLDV G +++  L Y+++ +  G  GG                    F+   G SG  P+  +  SS   P   +  +  + FD STV      L +   +W VG+Y+ SLG   L TGG IG   +    +WFK+ K S   YNL++CP   D   + C KVG+ +
Sbjct:   31 SDATPVLDVTGKELDPRLSYRIISIGRGALGGDVYLGKSPNSDAPCANGVFRFNSDVGPSGT-PVRFIGSSSHFGPHIFEGELLNIQFDISTV-----KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADS----SWFKIVKSSQLGYNLLYCPFSSDD--QFCLKVGVVH 190          
The following BLAST results are available for this feature:
BLAST of CV998080 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ASP_THECC1.290e-2437.1021 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU4.586e-2234.54Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
SPI5_SOLTU8.115e-1131.40Serine protease inhibitor 5 OS=Solanum tuberosum P... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_CTMN-6_T7 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC36_D05_041, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998080 ID=CV998080|Name=CV998080|organism=Citrus sinensis|type=EST|length=955bp
TTTTTTGAAAGAGACATAATTCATTGCATTTTGTATATATAAATCCAATG
AGGAGTTGCCATCAAGACGCATGTTTACATCGTAGAAAATAACAATTGCC
TCCGTGTTAAACACTCAAACCTAGCAATCTCTTGAGCCTTCAGTCCAAAA
TGCCACGGAATCGATCGTCATTTTTTTCCCCCTTTTACACATAACAAAGT
AGAAATTAACAGCATAAATATATCCCAGGCTAGCTAATTTATTTACTATT
AATCATAGAGATTAGAGTACTAGCTAGCCTGGTAAATTATTCAGAATATA
TAATATAGCTAGGTAATTCATTACATAGAGGATCTTGAAGGATTAGGAGC
TGGAAATAACACCAACCGCAGAGGCTGATCATCATCACGAACCAGAACTA
GACGTCGAACGCCGTCCACATAGAAGATGCCGACTTTGTTACAGAGTTTA
ACGCAAGAATCGCAAACAGATGGACAATGAACAAGATTGTATATACTGAC
ACTAACTTTCTCAAGCTTAAACCAATTTAGCAACGTTTTAGCTCCTGGGT
GGCCGATGATTCCGCCGGTTGTTAGAAACCATTTTCCTAATGAATCATTA
TAGTTTCCAACTGTCCATACTGGTTCTATCAAGTTGAGATCAGTGGATTC
CCGGACAACTGTAGAATTGTCAAACGGTAATAATCTTACATAATGATCCC
TTTCCGTAGGAGAACTTAGTTGGACAACGTCCAACGGACACTCTCCACTT
GTGCCTCCATGTATACTGAATCCACCACTAGTGCCATTTTTGACTTCGAG
AAGCTTATACTCGAGGTTGGATTCGACCTTGTTGCCATAGACATCTAAGA
CTGGTTCAGATTCTGAGGTGCCCAACTGAGCTTTTGTGGCCAAGGCAAGG
ATAAGGAATGAGAGTTTTACTACGAATGAAGTCTTCATTTTATTTATTTA
TTTGA
back to top