CV998078

Overview
NameCV998078
Unique NameCV998078
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length991
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10123 contig Csv1_Contig10123:852..1843. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALA2_HORVU (Alanine aminotransferase 2 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 441.425 bits (1134), Expect = 3.738e-123
Identity = 218/297 (73.40%), Postives = 249/297 (83.84%), Query Frame = -3
Query:  105 GALLPR*SNRM---GIETSEVKKQWEAAKAKGITVRALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKFRN 986
            GAL+P   N     G+ETS+VKKQ E A+++GI VRALVVINPGNPTGQVLAEENQ  IV+FCK EGLVLLADEVYQEN+YV  KKFHSFKK+ RS+GYGE+D+ LVS+QSVSKGYYGECGKRGGY E+TGFSA VREQIYK+ASVNLCSNI+GQILASLVM+PPK  DESY SY AE+DGIL+SLARRAK LE AFN LEGITCN+AEGAMY+FP+I LP             PDAFY  RLL +TGIV+VPGSGFGQVPGTWHFRCTILPQEDKIPA+++R T FH+ FM ++R+
Sbjct:  186 GALVPYYLNESTGWGLETSDVKKQLEDARSRGINVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKKFHSFKKIVRSLGYGEEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKAIEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRFTVFHEAFMSEYRD 482          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALA2_PANMI (Alanine aminotransferase 2 OS=Panicum miliaceum PE=1 SV=1)

HSP 1 Score: 440.269 bits (1131), Expect = 8.327e-123
Identity = 214/283 (75.62%), Postives = 244/283 (86.22%), Query Frame = -3
Query:  105 GIETSEVKKQWEAAKAKGITVRALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKFRN 953
            G+E S++KKQ E A++KGI VRALVVINPGNPTGQVLAE+NQ  IV FCK EGLVLLADEVYQEN+YV +KKF+SFKK++RS+GYGE D+ LVSFQSVSKGYYGECGKRGGYME+TGFSA VREQIYK+ASVNLCSNI+GQILASLVM+PPKVGDESY +Y AE+DGIL SLARRAK LEDAFN+LEGI+CNKAEGAMYLFP+I LP             PDAFY  RLL +TGIV+VPGSGFGQVPGTWH RCTILPQEDKIPA++TR   FH+ FM ++R+
Sbjct:  200 GLEISDLKKQLEDARSKGIDVRALVVINPGNPTGQVLAEDNQCDIVRFCKNEGLVLLADEVYQENIYVDDKKFNSFKKIARSVGYGEDDLPLVSFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKVGDESYAAYKAEKDGILQSLARRAKALEDAFNNLEGISCNKAEGAMYLFPQIHLPKKAIEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHIRCTILPQEDKIPAVITRFKAFHEAFMAEYRD 482          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAM_DICDI (Probable alanine aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=gpt PE=3 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 2.368e-85
Identity = 151/282 (53.55%), Postives = 200/282 (70.92%), Query Frame = -3
Query:  108 IETSEVKKQWEAAKAKGITVRALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKK-FHSFKKVSRSMGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKFR 950
            +E S+++  +  A +KGI  RALV+INPGNPTGQ L   N   IV+FC ++ +VLLADEVYQENVYV E K F SFKKV + MG    D+ +VSF SVSKG+ GECGKRGGYME+ G + +V+ +IYK+AS+ LC N+ GQ++  L++ PP  G++S++ Y  ERD I  SL +RA  L +A N+LEG+TCN +EGAMY FP+I+LP             PDA+YC +LL ATGI +VPGSGFGQ  GTWHFR T LP E+ I  +  R+ DFH++FM+K++
Sbjct:  253 LEISQLEHSYNDAVSKGINPRALVIINPGNPTGQCLDRANMEEIVKFCLEKNVVLLADEVYQENVYVKESKPFISFKKVVKDMGGDYADLEMVSFHSVSKGFVGECGKRGGYMELNGVTQDVKAEIYKLASIGLCPNVIGQLVVDLMVRPPVAGEQSHDLYLKERDNIYESLKKRANLLTNALNNLEGVTCNPSEGAMYAFPQIRLPAKAVEYANSIGKAPDAYYCIQLLEATGICVVPGSGFGQKDGTWHFRTTFLPSEEAIEGVCKRIADFHQSFMNKYK 534          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAT2_MOUSE (Alanine aminotransferase 2 OS=Mus musculus GN=Gpt2 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 8.612e-72
Identity = 128/261 (49.04%), Postives = 174/261 (66.67%), Query Frame = -3
Query:  111 RALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYG-EKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKF 890
            + L +INPGNPTGQV + +    ++ F  +E L LLADEVYQ+NVY P+ +FHSFKKV   MG+    ++ L SF S SKGY GECG RGGYMEV     E++ Q+ K+ SV LC  +SGQ    +V++PP+ G+ES+E +  E++ +L +LA++AK  ED FN + GI CN  +GAMY FPRI +P          K  PD FYC +LL  TGI +VPGSGFGQ  GT+HFR TILP  DK+  ++ ++ DFH  F++++
Sbjct:  261 KVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYQMGHEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPEPGEESFEQFSREKEFVLGNLAKKAKLTEDLFNQVPGIQCNPLQGAMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVDKLKTVLHKVKDFHLKFLEQY 521          

HSP 2 Score: 25.0238 bits (53), Expect = 8.612e-72
Identity = 15/34 (44.12%), Postives = 17/34 (50.00%), Query Frame = -1
Query:  896 VPYYLDEATGWGLKLRRLRSNGRPPR----PKVL 985
            V YYLDE   W L +  LR   R  +    PKVL
Sbjct:  230 VNYYLDEENCWALNVDELRRALRQAKDHCDPKVL 263          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAT2_HUMAN (Alanine aminotransferase 2 OS=Homo sapiens GN=GPT2 PE=1 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 7.397e-71
Identity = 132/285 (46.32%), Postives = 183/285 (64.21%), Query Frame = -3
Query:  111 NRMGIETSEVKKQWEAAKAKGITVRALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYG-EKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKF 962
            N   +  +E+++  + AK      + L +INPGNPTGQV + +    ++ F  +E L LLADEVYQ+NVY P+ +FHSFKKV   MG     ++ L SF S SKGY GECG RGGYMEV     E++ Q+ K+ SV LC  +SGQ    +V++PP  G+ES+E +  E++ +L +LA++AK  ED FN + GI CN  +GAMY FPRI +P          +  PD FYC +LL  TGI +VPGSGFGQ  GT+HFR TILP  +K+  ++ ++ DFH NF++K+
Sbjct:  239 NCWALNVNELRRAVQEAKDH-CDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKY 522          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAT2_DANRE (Alanine aminotransferase 2-like OS=Danio rerio GN=gpt2l PE=2 SV=2)

HSP 1 Score: 266.544 bits (680), Expect = 1.648e-70
Identity = 136/282 (48.23%), Postives = 182/282 (64.54%), Query Frame = -3
Query:  111 IETSEVKKQWEAAKAKGITVRALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMG--YGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKF 950
            ++ SE+++  +AA+ K    R L +INPGNPTGQV + +    +++F  KE L L+ADEVYQ+NVY    +FHSFKKV   MG  Y +K + L SF S SK Y GECG RGGYMEV    A+V+ Q+ K+ SV LC    GQ L  LV++PP+ G+ S++++  ER  +LS+LA +AK  E   N++ GI+CN  +GAMY FPRI LP             PD FYC +LL  TGI LVPGSGFGQ  GT+HFR TILP  DK+  ++ +L DFH+ F  ++
Sbjct:  269 LDISELQRSLQAAR-KHCNPRVLCIINPGNPTGQVQSRQCIEDVIQFAAKENLFLMADEVYQDNVYAKGCEFHSFKKVLFEMGPEYSKK-VELASFHSTSKCYMGECGFRGGYMEVINMDADVKAQLTKLVSVRLCPPAPGQALMDLVVNPPQPGEPSHQTFMQERTAVLSALAEKAKLTEQILNTVPGISCNPVQGAMYSFPRITLPERAISEAKAKGQAPDMFYCMKLLEETGICLVPGSGFGQREGTYHFRMTILPPTDKLKLMLNKLKDFHQRFTQQY 548          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAT1_RAT (Alanine aminotransferase 1 OS=Rattus norvegicus GN=Gpt PE=1 SV=2)

HSP 1 Score: 256.529 bits (654), Expect = 6.579e-69
Identity = 131/262 (50.00%), Postives = 166/262 (63.36%), Query Frame = -3
Query:  111 RALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMG--YGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKF 890
            R L VINPGNPTGQV   E   A++ F  KEGL L+ADEVYQ+NVY    +FHSFKKV   MG  Y  +   L SF SVSKGY GECG RGGY+EV    AEV++Q+ K+ SV LC  + GQ L  +V+SPP   + S++ + AER  +L+ LA +AK  E  FN   GI CN  +GAMY FP++QLP             PD F+C  LL  TGI +VPGSGFGQ  GT+HFR TILP  +K+  ++ +L+ FH  F  ++
Sbjct:  235 RVLCVINPGNPTGQVQTRECIEAVIRFAFKEGLFLMADEVYQDNVYAEGSQFHSFKKVLMEMGPPYSTQQ-ELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMGKLMSVRLCPPVPGQALMDMVVSPPTPSEPSFKQFQAERQEVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPQVQLPLKAVQRAQELGLAPDMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRLLLEKLSHFHAKFTHEY 495          

HSP 2 Score: 25.409 bits (54), Expect = 6.579e-69
Identity = 10/19 (52.63%), Postives = 11/19 (57.89%), Query Frame = -1
Query:  929 VPYYLDEATGWGLKLRRLR 985
            V YYLDE   W L +  LR
Sbjct:  204 VDYYLDEERAWALDIAELR 222          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAT2_XENLA (Alanine aminotransferase 2 OS=Xenopus laevis GN=gpt2 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 6.923e-69
Identity = 130/286 (45.45%), Postives = 180/286 (62.94%), Query Frame = -3
Query:  111 NRMGIETSEVKKQWEAAKAKGITVRALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMG--YGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKF 962
            N   ++ +E+++    A+ K    + L +INPGNPTGQV + +    ++ F  +E L L+ADEVYQ+NVY     FHSFKKV   MG  Y E  + L SF S SKGY GECG RGGYMEV      V++Q+ K+ SV LC  + GQ+L  ++++PPK G+ SY+ + +E+  +L++LA +A+  E+  N   GI CN  +GAMY FPRI +P             PD F+C +LL  TGI +VPGSGFGQ  GT HFR TILP  DK+ +++ RL DFH+ FMD++
Sbjct:  256 NCWALDINELRRALAEAR-KHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCAFHSFKKVLFEMGPKYSET-LELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQVLLDVIVNPPKPGEPSYKQFISEKQAVLNNLAEKARLTEEILNQAPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFMDEY 539          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAT1_MOUSE (Alanine aminotransferase 1 OS=Mus musculus GN=Gpt PE=2 SV=3)

HSP 1 Score: 255.373 bits (651), Expect = 1.459e-68
Identity = 131/262 (50.00%), Postives = 165/262 (62.98%), Query Frame = -3
Query:  111 RALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMG--YGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKF 890
            R L VINPGNPTGQV   E   A++ F  +EGL L+ADEVYQ+NVY    +FHSFKKV   MG  Y  +   L SF SVSKGY GECG RGGY+EV    AEV++Q+ K+ SV LC  + GQ L  +V+SPP   + S++ + AER  +L+ LA +AK  E  FN   GI CN  +GAMY FP+IQLP             PD F+C  LL  TGI +VPGSGFGQ  GT+HFR TILP  +K+  ++ +L  FH  F  ++
Sbjct:  235 RVLCVINPGNPTGQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPYATQQ-ELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMAKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAERQEVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFHAKFTHEY 495          

HSP 2 Score: 25.409 bits (54), Expect = 1.459e-68
Identity = 10/19 (52.63%), Postives = 11/19 (57.89%), Query Frame = -1
Query:  929 VPYYLDEATGWGLKLRRLR 985
            V YYLDE   W L +  LR
Sbjct:  204 VDYYLDEERAWALDIAELR 222          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAT1_BOVIN (Alanine aminotransferase 1 OS=Bos taurus GN=GPT PE=1 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.459e-68
Identity = 130/262 (49.62%), Postives = 163/262 (62.21%), Query Frame = -3
Query:  111 RALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMG--YGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKF 890
            RAL VINPGNPTGQV   E    ++ F  +E L LLADEVYQ+NVY    +FHSFKKV   MG  Y  +   L SF S+SKGY GECG RGGY+EV    A V++Q+ K+ SV LC    GQ+L  + +SPP   D S+  + AER  +L+ LA +AK  E  FN   GI CN  +GAMY FPR+QLP             PD F+C RLL  TGI +VPGSGFGQ  GT+HFR TILP  +K+  ++ +L+ FH  F  ++
Sbjct:  235 RALCVINPGNPTGQVQTRECIEDVIRFAYEEKLFLLADEVYQDNVYAESSQFHSFKKVLTEMGPPYAAQQ-ELASFHSISKGYMGECGFRGGYVEVVNMDAAVKQQMQKLRSVRLCPPTPGQVLLDVAVSPPAPSDPSFPRFQAERRAVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPRVQLPPRAVQRAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPMEKLRPLLEKLSQFHAKFTREY 495          

HSP 2 Score: 26.1794 bits (56), Expect = 1.459e-68
Identity = 13/31 (41.94%), Postives = 14/31 (45.16%), Query Frame = -1
Query:  893 VPYYLDEATGWGLKLRRLRSNGRPPRPKVLP 985
            V YYLDE   W L +  LR   R  R    P
Sbjct:  204 VDYYLDEERAWALDVAELRRALRQARDHCRP 234          
The following BLAST results are available for this feature:
BLAST of CV998078 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
ALA2_HORVU3.738e-12373.40Alanine aminotransferase 2 OS=Hordeum vulgare PE=2... [more]
ALA2_PANMI8.327e-12375.62Alanine aminotransferase 2 OS=Panicum miliaceum PE... [more]
ALAM_DICDI2.368e-8553.55Probable alanine aminotransferase, mitochondrial O... [more]
ALAT2_MOUSE8.612e-7249.04Alanine aminotransferase 2 OS=Mus musculus GN=Gpt2... [more]
ALAT2_HUMAN7.397e-7146.32Alanine aminotransferase 2 OS=Homo sapiens GN=GPT2... [more]
ALAT2_DANRE1.648e-7048.23Alanine aminotransferase 2-like OS=Danio rerio GN=... [more]
ALAT1_RAT6.579e-6950.00Alanine aminotransferase 1 OS=Rattus norvegicus GN... [more]
ALAT2_XENLA6.923e-6945.45Alanine aminotransferase 2 OS=Xenopus laevis GN=gp... [more]
ALAT1_MOUSE1.459e-6850.00Alanine aminotransferase 1 OS=Mus musculus GN=Gpt ... [more]
ALAT1_BOVIN1.459e-6849.62Alanine aminotransferase 1 OS=Bos taurus GN=GPT PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_CTMN-5_T7 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC35_C05_043, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998078 ID=CV998078|Name=CV998078|organism=Citrus sinensis|type=EST|length=991bp
GTACGCTTTGTCCATTCACTCTGTAAACGTTTAACAATTGAAATGAATGG
CTACACATTATTTTTCTGAACTCAGTCTCATATTATTATGCAGAAGATCT
TTCAATTACGGAATTTGTCCATGAAATTTTTATGGAAGTCTGTCAGCCGG
GTCACAATCGCTGGAATCTTGTCCTCTTGAGGCAATATGGTGCACCTAAA
ATGCCAAGTGCCGGGGACCTGCCCAAAACCAGAACCAGGAACAAGAACAA
TTCCAGTGGCATTGAGAAGGCGGCGACAATAAAATGCATCTGGAACAGTT
TTTTCAGCTTCAGCAGCTTTAATTGCCTTTTCAGGCAGTTGAATACGAGG
AAAGAGATACATTGCTCCTTCAGCCTTGTTACATGTTATTCCTTCCAAAC
TGTTAAATGCATCTTCCAATGTCTTTGCACGCCTGGCTAAAGATGAGAGG
ATTCCATCCCTCTCAGCGCAATAGGACTCATAAGATTCATCTCCAACCTT
AGGTGGACTCATGACAAGGCTTGCCAGAATTTGGCCGGAGATATTAGAAC
AAAGATTCACAGATGCCACTTTGTATATTTGCTCCCTTACTTCAGCACTG
AACCCAGTGACCTCCATGTAACCTCCTCTTTTTCCACACTCCCCATAGTA
ACCTTTAGAAACTGACTGAAATGATACAAGGGATATATCCTTCTCACCAT
ACCCCATGGATCGGGATACCTTCTTAAAGGAATGGAATTTTTTCTCTGGC
ACATAAACATTTTCCTGGTATACCTCATCTGCAAGAAGAACAAGACCCTC
CTTTTTGCAGAACTCCACAATTGCACGCTGGTTTTCTTCAGCAAGAACCT
GTCCAGTTGGATTGCCTGGATTTATTACAACCAAGGCCCTAACGGTAATA
CCTTTGGCCTTGGCGGCCTCCCATTGCTTCTTAACCTCCGAAGTTTCAAT
CCCCATCCTGTTGCTTCATCTAGGTAGTAAGGCACCAAGGT
back to top