CV998076

Overview
NameCV998076
Unique NameCV998076
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length574
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig328 contig Csv1_Contig328:649..1223. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998076 vs. ExPASy Swiss-Prot
Match: RD21A_ARATH (Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 4.928e-39
Identity = 59/85 (69.41%), Postives = 75/85 (88.24%), Query Frame = -2
Query:  253 CDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYWAHGNQ 507
            CD+YY+CPESNTCCC+FEYG  CFAWGCCPLEAATCCDD+YSCCPH+YP+C++  GTCL+SK++P  V+AL+R PA P+W+ G +
Sbjct:  375 CDSYYTCPESNTCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALKRKPATPFWSQGRK 459          
BLAST of CV998076 vs. ExPASy Swiss-Prot
Match: ORYA_ORYSJ (Oryzain alpha chain OS=Oryza sativa subsp. japonica GN=Os04g0650000 PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 4.928e-39
Identity = 61/79 (77.22%), Postives = 72/79 (91.14%), Query Frame = -2
Query:  274 VCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKP 510
            VCDNYY+CP+S TCCC++EYG  C+AWGCCPLE ATCCDDHYSCCPH+YPICNV+ GTCLM+KD+PL V+AL+RT AKP
Sbjct:  366 VCDNYYTCPDSTTCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKALKRTLAKP 444          
BLAST of CV998076 vs. ExPASy Swiss-Prot
Match: CYSPL_SOLLC (Low-temperature-induced cysteine proteinase (Fragment) OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 1.641e-34
Identity = 57/86 (66.28%), Postives = 66/86 (76.74%), Query Frame = -2
Query:  250 CDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAKPYWAHGNQG 507
            CD Y  C    TCCC+ ++  SCF+WGCCPLE ATCC+DHYSCCPHDYPICNVR GTC MSK NPLGV+A++R  A+P  A GN G
Sbjct:  256 CDEYSQCAVGTTCCCILQFRRSCFSWGCCPLEGATCCEDHYSCCPHDYPICNVRQGTCSMSKGNPLGVKAMKRILAQPIGAFGNGG 341          
BLAST of CV998076 vs. ExPASy Swiss-Prot
Match: ORYB_ORYSJ (Oryzain beta chain OS=Oryza sativa subsp. japonica GN=Os04g0670200 PE=1 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 2.075e-29
Identity = 50/78 (64.10%), Postives = 60/78 (76.92%), Query Frame = -2
Query:  277 VCDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRALRRTPAK 510
            VCD+ +SCP  +TCCC F + N C  WGCCP+E ATCC DH SCCP DYP+CN RAGTC  SK++PL V+AL+RT AK
Sbjct:  385 VCDDNFSCPAGSTCCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPDYPVCNTRAGTCSASKNSPLSVKALKRTLAK 462          
BLAST of CV998076 vs. ExPASy Swiss-Prot
Match: CYSP1_ORYSJ (Cysteine protease 1 OS=Oryza sativa subsp. japonica GN=CP1 PE=2 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 1.441e-22
Identity = 40/82 (48.78%), Postives = 50/82 (60.98%), Query Frame = -2
Query:  274 CDNYYSCPESNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVRA----LRRTPAKP 507
            CD Y  CP   TCCC +   N C  WGCCP+E ATCC DH +CCP +YP+CN +A TC  SK++P  +R      R  P +P
Sbjct:  395 CDRYSKCPAGTTCCCNYGIRNHCIVWGCCPVEGATCCKDHSTCCPKEYPVCNAKARTCSKSKNSPYNIRTPAAMARSVPEQP 476          
The following BLAST results are available for this feature:
BLAST of CV998076 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
RD21A_ARATH4.928e-3969.41Cysteine proteinase RD21a OS=Arabidopsis thaliana ... [more]
ORYA_ORYSJ4.928e-3977.22Oryzain alpha chain OS=Oryza sativa subsp. japonic... [more]
CYSPL_SOLLC1.641e-3466.28Low-temperature-induced cysteine proteinase (Fragm... [more]
ORYB_ORYSJ2.075e-2964.10Oryzain beta chain OS=Oryza sativa subsp. japonica... [more]
CYSP1_ORYSJ1.441e-2248.78Cysteine protease 1 OS=Oryza sativa subsp. japonic... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_CTMN-4_T7 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC34_B05_045, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998076 ID=CV998076|Name=CV998076|organism=Citrus sinensis|type=EST|length=574bp
TTTTTTTTTTTTTTTGTGCATTGTTCAGATTCACGCAGATAGATAACTTA
CAACGCTATATACCAAACCAACGTCCGAATAAATATTTAACAGACCATCC
ACCTGCCGGTACATTAACGTTTGGAATGAAATGCAGTAGAATGAACTAAG
GCCGGGGAGAAACTCATTCACAAGCACGAATATTTTCATCCTCCCTTCGG
CCTTCCACTGCTCTTACAGTGCCAACTATAATTAAGCACTGCTACTTCCA
CCTTGATTTCCATGAGCCCAGTAAGGTTTAGCAGGGGTGCGTCGTAATGC
CCTCACTCCCAATGGGTTGTCCTTGCTCATCAAGCAGGTCCCAGCACGAA
CATTACAGATGGGATAGTCATGTGGGCAGCAGCTATAGTGGTCATCACAG
CAGGTGGCAGCCTCAAGCGGGCAGCATCCCCATGCAAAGCAAGAGTTACC
ATACTCAAAGACACAGCAGCAAGTGTTGCTCTCAGGGCAAGAGTAATAAT
TGTCACACACAGCAGGAGGCTTTGTTGGAGATGGAGGGGACGGTCCAGGG
TTGGGAGGATTTTGGCCTTTCCCT
back to top