CV998070

Overview
NameCV998070
Unique NameCV998070
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10695 contig Csv1_Contig10695:1247..2124. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998070 vs. ExPASy Swiss-Prot
Match: FATB_GOSHI (Myristoyl-acyl carrier protein thioesterase, chloroplastic OS=Gossypium hirsutum GN=FATB1 PE=1 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.132e-48
Identity = 92/132 (69.70%), Postives = 110/132 (83.33%), Query Frame = -1
Query:  480 EDSRKLPKLGDSTADYVRRGLTPRWSDLDVNQHVNNVKYIGWILESAPQQILESHQLASVTLEYRRECGRDSVLQSLTAVSDKDIGNLVNLGSVECQHLLRLEEGAEVLRARTEWRPKDAHNFGNVGPIPAE 875
            EDS+KL KL DSTA++V +GLTP+WSDLDVNQHVNNVKYIGWILESAP  ILESH+L+++TLEYRRECGRDSVLQSLT VSD +  N VN+G   CQHLLRL++GAE++R RT WRPK A +  N+  I A+
Sbjct:  280 EDSQKLVKLDDSTAEHVCKGLTPKWSDLDVNQHVNNVKYIGWILESAPLPILESHELSALTLEYRRECGRDSVLQSLTTVSDSNTENAVNVGEFNCQHLLRLDDGAEIVRGRTRWRPKHAKSSANMDQITAK 411          
BLAST of CV998070 vs. ExPASy Swiss-Prot
Match: FATB_CINCA (Myristoyl-acyl carrier protein thioesterase, chloroplastic OS=Cinnamomum camphora GN=FATB1 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.134e-40
Identity = 82/135 (60.74%), Postives = 101/135 (74.81%), Query Frame = -1
Query:  474 DEDSRKLPKLGDSTADYVRRGLTPRWSDLDVNQHVNNVKYIGWILESAPQQILESHQLASVTLEYRRECGRDSVLQSLTAVSDKDIGNLVNLGSVECQHLLRLEEGAEVLRARTEWRPKDAHNFGNVGPIPAEST 878
            DE+ +K  KL DSTADY++ GLTPRW+DLD+NQHVNN+KY+ WILE+ P  I ESH ++S T+EYRREC  DSVLQSLT VS    G     G V C+HLL+LE G+EVLRA+TEWRPK   +F  +  IPAES+
Sbjct:  252 DEEIKKPQKLNDSTADYIQGGLTPRWNDLDINQHVNNIKYVDWILETVPDSIFESHHISSFTIEYRRECTMDSVLQSLTTVS----GGSSEAGLV-CEHLLQLEGGSEVLRAKTEWRPKLTDSFRGISVIPAESS 381          
BLAST of CV998070 vs. ExPASy Swiss-Prot
Match: FATB_UMBCA (Lauroyl-acyl carrier protein thioesterase, chloroplastic OS=Umbellularia californica GN=FATB1 PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.482e-40
Identity = 82/133 (61.65%), Postives = 99/133 (74.44%), Query Frame = -1
Query:  480 DEDSRKLPKLGDSTADYVRRGLTPRWSDLDVNQHVNNVKYIGWILESAPQQILESHQLASVTLEYRRECGRDSVLQSLTAVSDKDIGNLVNLGSVECQHLLRLEEGAEVLRARTEWRPKDAHNFGNVGPIPAE 878
            D++ +KL KL DSTADY++ GLTPRW+DLDVNQHVNN+KY+ W+ E+ P  I ESH ++S TLEYRREC RDSVL+SLT VS    G     G V C HLL+LE G+EVLRARTEWRPK   +F  +  IPAE
Sbjct:  252 DDEIKKLQKLNDSTADYIQGGLTPRWNDLDVNQHVNNLKYVAWVFETVPDSIFESHHISSFTLEYRRECTRDSVLRSLTTVS----GGSSEAGLV-CDHLLQLEGGSEVLRARTEWRPKLTDSFRGISVIPAE 379          
BLAST of CV998070 vs. ExPASy Swiss-Prot
Match: FATB_CUPHO (Myristoyl-acyl carrier protein thioesterase, chloroplastic OS=Cuphea hookeriana GN=FATB1 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 9.603e-40
Identity = 78/120 (65.00%), Postives = 98/120 (81.67%), Query Frame = -1
Query:  519 DEDSRKLPKLGDSTADYVRRGLTPRWSDLDVNQHVNNVKYIGWILESAPQQILESHQLASVTLEYRRECGRDSVLQSLTAVSDKDIGNLVNLGSVECQHLLRLEEGAEVLRARTEWRPKD 878
            ++D RKLPKL + TAD +R+GLTPRW+DLDVNQHVNNVKYIGWILES P ++LE+ +L S+TLEYRRECGR+SVL+SLTA+     G     GS + QHLLRLE+G E+++ RTEWRPK+
Sbjct:  283 EDDDRKLPKLDEKTADSIRKGLTPRWNDLDVNQHVNNVKYIGWILESTPPEVLETQELCSLTLEYRRECGRESVLESLTAMDPSGGG----YGS-QFQHLLRLEDGGEIVKGRTEWRPKN 397          
BLAST of CV998070 vs. ExPASy Swiss-Prot
Match: FATA_CORSA (Oleoyl-acyl carrier protein thioesterase, chloroplastic (Fragment) OS=Coriandrum sativum GN=FATA PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.819e-22
Identity = 58/137 (42.34%), Postives = 86/137 (62.77%), Query Frame = -1
Query:  522 DEDSRKLPKLG--DSTADYVRRGLTPRWSDLDVNQHVNNVKYIGWILESAPQQILESHQLASVTLEYRRECGRDSVLQSLTAVS-DKDIGNLVNLG--------------SVECQHLLRLE-EGAEVLRARTEWRPK 878
            +E+++ L K+   +  A + R GL+PR +DLD+NQHVNNV YIGW+LES P+++L +H+L ++TL+YRREC  D V+ SLT+   D+D      +G              S++  H LR+  +G E+ R RTEWR K
Sbjct:  229 EENNKSLKKISKLEDPAQHSRLGLSPRRADLDMNQHVNNVAYIGWVLESIPKEVLYTHELETITLDYRRECQHDDVVDSLTSPEVDEDTAVTKIIGTNGHAAAATEARDDSLKFLHFLRVSGQGLEINRGRTEWRKK 365          
The following BLAST results are available for this feature:
BLAST of CV998070 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
FATB_GOSHI1.132e-4869.70Myristoyl-acyl carrier protein thioesterase, chlor... [more]
FATB_CINCA1.134e-4060.74Myristoyl-acyl carrier protein thioesterase, chlor... [more]
FATB_UMBCA1.482e-4061.65Lauroyl-acyl carrier protein thioesterase, chlorop... [more]
FATB_CUPHO9.603e-4065.00Myristoyl-acyl carrier protein thioesterase, chlor... [more]
FATA_CORSA1.819e-2242.34Oleoyl-acyl carrier protein thioesterase, chloropl... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_CTMN-1_T7 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC31_G04_020, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998070 ID=CV998070|Name=CV998070|organism=Citrus sinensis|type=EST|length=878bp
TTTTTTTTTTTTTTTTTGATGAAAAATAATTATTATTGGCAAAGTCGAAA
CACAAATTCGGTTGCCTAACTCTCCTCGATTCTAACTAGAACCCTAAAAC
CAAACCAAAAAATATACACGTCCTGTCCATCTAAAGGTCAAGGTAACATG
AGGGTACCACCACCAACCGAAAATGTTAGGCAAAGCATAAGTGAATCTTG
TCCCTCTATACAAACTCAGTCATCCTCAGCAGCTAGCTAATTGATTCGGC
AATGCAGGGAGCGAGAAACACAGCGCAGCAAACGCTAATTACAATGAAAC
TTACAACCTTTTTTTTTTTTTAAAGAAAGAAGATGAATAAGATATGTGTA
TATAGATATATATTTTTAAATATATAAGCGAACATATATAGATCCAAGAG
CACACAGCATTCTACACGAGCAATGTGACACACGGCAGCGCGACCACCGC
ATCTCCGAGAAACTTGGGTTTTAAGTGCTTTCTGCAGGGATTGGACCAAC
ATTCCCAAAGTTGTGGGCATCCTTTGGCCTCCATTCAGTCCTTGCTCTCA
AAACTTCAGCACCTTCCTCTAGTCGGAGCAAGTGCTGGCACTCCACACTG
CCCAAGTTCACCAAATTGCCAATGTCCTTGTCTGAGACAGCAGTCAGGGA
CTGCAACACACTGTCCCTTCCGCACTCCCTCCTATACTCCAGGGTCACAG
ATGCCAGCTGATGACTCTCCAAGATCTGCTGAGGAGCACTCTCTAGGATC
CAGCCAATGTACTTCACATTATTGACATGCTGGTTGACATCTAAATCACT
CCACCTAGGAGTTAAACCTCTACGAACATAATCTGCAGTACTGTCGCCAA
GTTTTGGTAATTTCCTGCTATCCTCATC
back to top