CV998069

Overview
NameCV998069
Unique NameCV998069
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length864
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10695 contig Csv1_Contig10695:566..1429. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998069 vs. ExPASy Swiss-Prot
Match: FATB_GOSHI (Myristoyl-acyl carrier protein thioesterase, chloroplastic OS=Gossypium hirsutum GN=FATB1 PE=1 SV=1)

HSP 1 Score: 452.595 bits (1163), Expect = 1.321e-126
Identity = 221/288 (76.74%), Postives = 245/288 (85.07%), Query Frame = 1
Query:    1 NGTSVGLTTPAESLKNGDISTSSPPPRTFINQLPDWSMXXXXXXXXXXXXEKQWMMLDWKPRRSDMLVDPFGIGKIVQDGFIFRQNFSIRSYEIGADGTASIETLMNHLQETALNHVMTAGLLDAGFGATPAMAKKNLIWVVTRMQVVVDRYPTWNDVVNVETWVSASGKNGMRRDWLIRNAKTGETLTRATSLWVMMNKLTRRLSKMPDEVRQEIEPYFLNSDPVVDEDSRKLPKLGDSTADYVRRGLTPRWSDLDVNQHVNNVKYIGWILESAPQQILESHQLASV 864
            NGT V  TTP E  KN D   SSPPPRTFINQLPDWSM            EKQWMMLDWKPRR DM++DPFGIGKIVQDG +F QNFSIRSYEIGAD TASIETLMNHLQETA+NH  +AGLL  GFGATP M KKNLIWVVTRMQVVVDRYPTW DVV V+TWVSASGKNGMRRDWL+ N++TGE LTRATS+WVMMNKLTRRLSK+P+EVR EIEP+F+NSDPV+ EDS+KL KL DSTA++V +GLTP+WSDLDVNQHVNNVKYIGWILESAP  ILESH+L+++
Sbjct:   54 NGT-VASTTPVEGSKNDD-GASSPPPRTFINQLPDWSMLLAAITTIFLAAEKQWMMLDWKPRRPDMVIDPFGIGKIVQDGLVFSQNFSIRSYEIGADQTASIETLMNHLQETAINHCRSAGLLGEGFGATPEMCKKNLIWVVTRMQVVVDRYPTWGDVVQVDTWVSASGKNGMRRDWLVSNSETGEILTRATSVWVMMNKLTRRLSKIPEEVRGEIEPFFMNSDPVLAEDSQKLVKLDDSTAEHVCKGLTPKWSDLDVNQHVNNVKYIGWILESAPLPILESHELSAL 339          
BLAST of CV998069 vs. ExPASy Swiss-Prot
Match: FATB_CUPHO (Myristoyl-acyl carrier protein thioesterase, chloroplastic OS=Cuphea hookeriana GN=FATB1 PE=2 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 8.033e-116
Identity = 198/288 (68.75%), Postives = 234/288 (81.25%), Query Frame = 1
Query:    1 NGTSVGLTTPAESLKNGDISTSSPPPRTFINQLPDWSMXXXXXXXXXXXXEKQWMMLDWKPRRSDMLVDPFGIGKIVQDGFIFRQNFSIRSYEIGADGTASIETLMNHLQETALNHVMTAGLLDAGFGATPAMAKKNLIWVVTRMQVVVDRYPTWNDVVNVETWVSASGKNGMRRDWLIRNAKTGETLTRATSLWVMMNKLTRRLSKMPDEVRQEIEPYFLNSDPVVDEDSRKLPKLGDSTADYVRRGLTPRWSDLDVNQHVNNVKYIGWILESAPQQILESHQLASV 864
            NG+ VGL +    LK  + + S+PPPRTFINQLPDWSM            EKQWMMLDWKP+R DMLVDPFG+G IVQDG +FRQNFSIRSYEIGAD TASIET+MNHLQETALNHV  AGL + GFG TP M K++LIWVV +MQV+V+RYPTW D V V TWV+ SGKNGMRRDWLI +  TGE LTRA+S+WVMMN+ TRRLSK+PDEVR EIEP+F++S PV+++D RKLPKL + TAD +R+GLTPRW+DLDVNQHVNNVKYIGWILES P ++LE+ +L S+
Sbjct:   58 NGSPVGLKSGG--LKTQEDAHSAPPPRTFINQLPDWSMLLAAITTVFLAAEKQWMMLDWKPKRPDMLVDPFGLGSIVQDGLVFRQNFSIRSYEIGADRTASIETVMNHLQETALNHVKIAGLSNDGFGRTPEMYKRDLIWVVAKMQVMVNRYPTWGDTVEVNTWVAKSGKNGMRRDWLISDCNTGEILTRASSVWVMMNQKTRRLSKIPDEVRNEIEPHFVDSPPVIEDDDRKLPKLDEKTADSIRKGLTPRWNDLDVNQHVNNVKYIGWILESTPPEVLETQELCSL 343          
BLAST of CV998069 vs. ExPASy Swiss-Prot
Match: FATB_UMBCA (Lauroyl-acyl carrier protein thioesterase, chloroplastic OS=Umbellularia californica GN=FATB1 PE=1 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 7.853e-79
Identity = 140/260 (53.85%), Postives = 181/260 (69.62%), Query Frame = 1
Query:   88 INQLPDWSMXXXXXXXXXXXXEKQWMMLDWKPRRS--DMLVDPFGIGKIVQDGFIFRQNFSIRSYEIGADGTASIETLMNHLQETALNHVMTAGLLDAGFGATPAMAKKNLIWVVTRMQVVVDRYPTWNDVVNVETWVSASGKNGMRRDWLIRNAKTGETLTRATSLWVMMNKLTRRLSKMPDEVRQEIEPYFLNSDPVVDEDSRKLPKLGDSTADYVRRGLTPRWSDLDVNQHVNNVKYIGWILESAPQQILESHQLAS 861
            + +LPDWSM            EKQW  L+WKP+     +L D FG+      G +FR+ F+IRSYE+G D + SI  +MNH+QE  LNH  + G+L  GFG T  M+K++L+WVV R  V V+RYPTW D V VE W+ ASG NGMRRD+L+R+ KTGE LTR TSL V+MN  TRRLS +PDEVR EI P F+++  V D++ +KL KL DSTADY++ GLTPRW+DLDVNQHVNN+KY+ W+ E+ P  I ESH ++S
Sbjct:   57 LKRLPDWSMLFAVITTIFSAAEKQWTNLEWKPKPKLPQLLDDHFGL-----HGLVFRRTFAIRSYEVGPDRSTSILAVMNHMQEATLNHAKSVGILGDGFGTTLEMSKRDLMWVVRRTHVAVERYPTWGDTVEVECWIGASGNNGMRRDFLVRDCKTGEILTRCTSLSVLMNTRTRRLSTIPDEVRGEIGPAFIDNVAVKDDEIKKLQKLNDSTADYIQGGLTPRWNDLDVNQHVNNLKYVAWVFETVPDSIFESHHISS 311          
BLAST of CV998069 vs. ExPASy Swiss-Prot
Match: FATB_CINCA (Myristoyl-acyl carrier protein thioesterase, chloroplastic OS=Cinnamomum camphora GN=FATB1 PE=2 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 1.026e-78
Identity = 143/260 (55.00%), Postives = 180/260 (69.23%), Query Frame = 1
Query:   88 INQLPDWSMXXXXXXXXXXXXEKQWMMLDWKPRRS--DMLVDPFGIGKIVQDGFIFRQNFSIRSYEIGADGTASIETLMNHLQETALNHVMTAGLLDAGFGATPAMAKKNLIWVVTRMQVVVDRYPTWNDVVNVETWVSASGKNGMRRDWLIRNAKTGETLTRATSLWVMMNKLTRRLSKMPDEVRQEIEPYFLNSDPVVDEDSRKLPKLGDSTADYVRRGLTPRWSDLDVNQHVNNVKYIGWILESAPQQILESHQLAS 861
            + +LPDWSM            EKQW  L+WKP+ +   +L D FG       G +FR+ F+IRSYE+G D + SI  +MNHLQE ALNH  + G+L  GFG T  M+K++LIWVV R  V V+RYP W D V VE WV ASG NG R D+L+R+ KTGE LTR TSL VMMN  TRRLSK+P+EVR EI P F+++  V DE+ +K  KL DSTADY++ GLTPRW+DLD+NQHVNN+KY+ WILE+ P  I ESH ++S
Sbjct:   57 LKKLPDWSMLFAVITTIFSAAEKQWTNLEWKPKPNPPQLLDDHFG-----PHGLVFRRTFAIRSYEVGPDRSTSIVAVMNHLQEAALNHAKSVGILGDGFGTTLEMSKRDLIWVVKRTHVAVERYPAWGDTVEVECWVGASGNNGRRHDFLVRDCKTGEILTRCTSLSVMMNTRTRRLSKIPEEVRGEIGPAFIDNVAVKDEEIKKPQKLNDSTADYIQGGLTPRWNDLDINQHVNNIKYVDWILETVPDSIFESHHISS 311          
BLAST of CV998069 vs. ExPASy Swiss-Prot
Match: FATA_CORSA (Oleoyl-acyl carrier protein thioesterase, chloroplastic (Fragment) OS=Coriandrum sativum GN=FATA PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 4.636e-55
Identity = 101/231 (43.72%), Postives = 151/231 (65.37%), Query Frame = 1
Query:  184 RRSDMLVDPFGIGKIVQDGFIFRQNFSIRSYEIGADGTASIETLMNHLQETALNHVMTAGLLDAGFGATPAMAKKNLIWVVTRMQVVVDRYPTWNDVVNVETWVSASGKNGMRRDWLIRNAKTGETLTRATSLWVMMNKLTRRLSKMPDEVRQEIEPYFLNSDPV--VDEDSRKLPKLG--DSTADYVRRGLTPRWSDLDVNQHVNNVKYIGWILESAPQQILESHQLASV 864
            +RS  L +   +G + +DG  +++ F +R YE+G + TA++ET+ N LQE   NH  + G    GF  TP M K +LIWV  RM + + RYP W+DVV +ETW  + G+ G RRDW+I++  T E + RATS WVMMN+ TRRL K+ D+VR E   +   +  +   +E+++ L K+   +  A + R GL+PR +DLD+NQHVNNV YIGW+LES P+++L +H+L ++
Sbjct:   61 KRSSSLAEKLRLGSLTEDGLSYKEKFIVRCYEVGINKTATVETIANLLQEVGGNHAQSVGFSTDGFATTPTMRKLHLIWVTARMHIEIYRYPAWSDVVEIETWCQSEGRIGTRRDWIIKDFATDEVIGRATSKWVMMNQDTRRLQKVSDDVRDEYLVFCPKTPRLSFPEENNKSLKKISKLEDPAQHSRLGLSPRRADLDMNQHVNNVAYIGWVLESIPKEVLYTHELETI 291          
The following BLAST results are available for this feature:
BLAST of CV998069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
FATB_GOSHI1.321e-12676.74Myristoyl-acyl carrier protein thioesterase, chlor... [more]
FATB_CUPHO8.033e-11668.75Myristoyl-acyl carrier protein thioesterase, chlor... [more]
FATB_UMBCA7.853e-7953.85Lauroyl-acyl carrier protein thioesterase, chlorop... [more]
FATB_CINCA1.026e-7855.00Myristoyl-acyl carrier protein thioesterase, chlor... [more]
FATA_CORSA4.636e-5543.72Oleoyl-acyl carrier protein thioesterase, chloropl... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_CTMN-1_T3 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC01_A01_015, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998069 ID=CV998069|Name=CV998069|organism=Citrus sinensis|type=EST|length=864bp
AATGGTACTTCAGTTGGTTTGACAACACCAGCAGAAAGTTTGAAGAATGG
TGATATCTCCACGTCATCACCTCCTCCTAGGACTTTTATTAACCAGTTAC
CTGACTGGAGTATGCTTCTTGCTGCTATAACAACAATCTTCTTGGCAGCA
GAGAAGCAGTGGATGATGCTTGATTGGAAACCAAGGCGATCTGACATGCT
TGTGGACCCATTTGGGATTGGGAAAATAGTTCAGGATGGTTTCATTTTCC
GGCAAAATTTCTCAATTAGATCATATGAGATAGGTGCTGATGGTACTGCA
TCTATAGAGACATTAATGAATCATTTACAGGAAACAGCGCTTAATCATGT
TATGACTGCTGGTCTTCTAGATGCTGGCTTTGGTGCAACCCCAGCGATGG
CTAAAAAGAACCTGATATGGGTGGTTACTCGGATGCAGGTTGTTGTAGAC
CGCTATCCCACTTGGAATGATGTTGTAAATGTAGAAACTTGGGTTAGTGC
ATCTGGAAAAAATGGTATGCGGCGTGATTGGCTCATTCGCAATGCTAAGA
CAGGTGAAACATTAACAAGAGCAACCAGTCTGTGGGTAATGATGAATAAA
CTGACTAGGAGGTTGTCCAAAATGCCCGATGAAGTTCGTCAGGAAATTGA
ACCGTATTTTCTGAATTCTGACCCTGTTGTCGATGAGGATAGCAGGAAAT
TACCAAAACTTGGCGACAGTACTGCAGATTATGTTCGTAGAGGTTTAACT
CCTAGGTGGAGTGATTTAGATGTCAACCAGCATGTCAATAATGTGAAGTA
CATTGGCTGGATCCTAGAGAGTGCTCCTCAGCAGATCTTGGAGAGTCATC
AGCTGGCATCTGTG
back to top