CV998068

Overview
NameCV998068
Unique NameCV998068
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1034
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6985 contig Csv1_Contig6985:511..1544. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998068 vs. ExPASy Swiss-Prot
Match: OPR1_SOLLC (12-oxophytodienoate reductase 1 OS=Solanum lycopersicum GN=OPR1 PE=1 SV=1)

HSP 1 Score: 504.982 bits (1299), Expect = 2.922e-142
Identity = 234/287 (81.53%), Postives = 265/287 (92.33%), Query Frame = -1
Query:  174 EQVEAWKPIVDAVHAKGGIFFCQIGHVGRVSNQDIQPNGQAPISCTDKPLTPQIRTNGVDIAQFTPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGFLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFEFNGPLNKYNRETFYVSDPVVGYTDYPFLDT 1034
            EQVEAWKPIVDAVHAKGGIFFCQI HVGRVSN+D QPNG+ PISCTD+ LTPQIR+NG+DIA FT PRRLTTDEIPQIVN+FR+AARNAIEAGFDG+E+HGAHG+LIDQFMKDQVNDR+D+YGGSLENRCRFALEIVEAV+NEIG+DRVGIR+SPFA+Y E+GD+NP ALGLYM ESLNKY + YCH+VEPRMKT  EK EC  SL+PMRKA+KGTF+VAGGYDREDGN+A+ E RADLV YGRLF++NPDLP+RFE N PLNKYNR+TFY SDP+VGYTDYPFL+T
Sbjct:   88 EQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNKDFQPNGEDPISCTDRGLTPQIRSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFALEIVEAVANEIGSDRVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYCHVVEPRMKTAWEKIECTESLVPMRKAYKGTFIVAGGYDREDGNRALIEDRADLVAYGRLFISNPDLPKRFELNAPLNKYNRDTFYTSDPIVGYTDYPFLET 374          
BLAST of CV998068 vs. ExPASy Swiss-Prot
Match: OPR2_ARATH (12-oxophytodienoate reductase 2 OS=Arabidopsis thaliana GN=OPR2 PE=2 SV=2)

HSP 1 Score: 486.878 bits (1252), Expect = 8.235e-137
Identity = 224/289 (77.51%), Postives = 261/289 (90.31%), Query Frame = -1
Query:  168 EQVEAWKPIVDAVHAKGGIFFCQIGHVGRVSNQDIQPNGQAPISCTDKPLTPQIRTNGVDIAQFTPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGFLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFEFNGPLNKYNRETFYVSDPVVGYTDYPFLDTSS 1034
            E VEAWKPIVDAVHAKGGIFFCQI HVGRVSN+  QP  QAPISCT KP+ PQ+R NG+D A+FTPPRRL+ +EIP IVNDFRLAARNA+EAGFDG+E+HGAHG+LIDQFMKD+VNDRTD+YGGSL+NRC+FALE+V+AV+ EIG DRVGIRLSPFA+YMESGD+NPEALGLYM ESLNKYGILYCHM+EPRMKTVGE + C H+L+PMR+AFKGTF+ AGG+ REDGN+A+A+GR DLV YGR FLANPDLP+RF+ + PLNKYNR TFY SDPVVGYTDYP L++++
Sbjct:   86 EHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNRGFQPRRQAPISCTGKPIMPQMRANGIDEARFTPPRRLSIEEIPGIVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQFMKDKVNDRTDEYGGSLQNRCKFALEVVDAVAKEIGPDRVGIRLSPFADYMESGDTNPEALGLYMVESLNKYGILYCHMIEPRMKTVGEIAACSHTLMPMREAFKGTFISAGGFTREDGNEAVAKGRTDLVAYGRWFLANPDLPKRFQLDAPLNKYNRSTFYTSDPVVGYTDYPSLESTA 374          
BLAST of CV998068 vs. ExPASy Swiss-Prot
Match: OPR1_ARATH (12-oxophytodienoate reductase 1 OS=Arabidopsis thaliana GN=OPR1 PE=1 SV=2)

HSP 1 Score: 483.026 bits (1242), Expect = 1.189e-135
Identity = 224/289 (77.51%), Postives = 260/289 (89.97%), Query Frame = -1
Query:  168 EQVEAWKPIVDAVHAKGGIFFCQIGHVGRVSNQDIQPNGQAPISCTDKPLTPQIRTNGVDIAQFTPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGFLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFEFNGPLNKYNRETFYVSDPVVGYTDYPFLDTSS 1034
            E VEAWKPIVDAVHAKGGIFFCQI HVGRVSN   QPNG+APISC+DKPL PQIR+NG+D A FTPPRRL  +EIP IVNDFRLAARNA+EAGFDG+E+HGA+G+LIDQFMKD VNDRTD+YGGSL+NRC+F LEIV+AV+ EIG DRVGIRLSPFA+YMESGD+NP ALGLYMAESLNKYGILYCH++E RMKT+GE   CPH+L+PMRKAFKGTF+ AGG+ REDGN+A+++GR DLV YGR FLANPDLP+RF+ + PLNKY+R TFY SDPVVGYTDYPFL++++
Sbjct:   84 EHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCSDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYMAESLNKYGILYCHVIEARMKTMGEVHACPHTLMPMRKAFKGTFISAGGFTREDGNEAVSKGRTDLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLESTA 372          
BLAST of CV998068 vs. ExPASy Swiss-Prot
Match: OPRL1_ARATH (Putative 12-oxophytodienoate reductase-like protein 1 OS=Arabidopsis thaliana GN=At1g09400 PE=2 SV=2)

HSP 1 Score: 419.853 bits (1078), Expect = 1.236e-116
Identity = 198/264 (75.00%), Postives = 224/264 (84.85%), Query Frame = -1
Query:  243 EQVEAWKPIVDAVHAKGGIFFCQIGHVGRVSNQDIQPNGQAPISCTDKPLTPQIRTNGVDIAQFTPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGFLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFEFNGPLNK 1034
            EQ+EAWKPIVDAVH+ GGIFFCQ+ H GRVS+QD QPNG++P+S TDKP             +FTPPRRL TDEIP I+NDFRLAARNA EAGFDG+E+HGAHG+LIDQFMKD VNDRTD YGGSLENRCRFAL+++EAVS EIG DRVGIRLSPFA+YMESGD++P+ LGLYMA+SLN++ ILYCHM+EPRMKTV E  EC  SL PMR AF GTF+VAGGY REDGNKA+AEGR DLV YGRLFLANPDLP+RFE N PLNK
Sbjct:   67 EQIEAWKPIVDAVHSHGGIFFCQLWHAGRVSHQDCQPNGESPVSSTDKPFADDPSN------EFTPPRRLRTDEIPTIINDFRLAARNATEAGFDGVEIHGAHGYLIDQFMKDSVNDRTDSYGGSLENRCRFALQVIEAVSKEIGPDRVGIRLSPFADYMESGDTDPKRLGLYMAKSLNRFEILYCHMIEPRMKTVSEIFECRESLTPMRNAFNGTFIVAGGYTREDGNKAVAEGRTDLVAYGRLFLANPDLPKRFELNAPLNK 324          
BLAST of CV998068 vs. ExPASy Swiss-Prot
Match: OPR3_SOLLC (12-oxophytodienoate reductase 3 OS=Solanum lycopersicum GN=OPR3 PE=1 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 2.057e-87
Identity = 162/305 (53.11%), Postives = 214/305 (70.16%), Query Frame = -1
Query:  180 EQVEAWKPIVDAVHAKGGIFFCQIGHVGRVSNQDIQPNGQAPISCTDKPLTPQIR------TNGVDIAQFTPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGFLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKY------GILYCHMVEPRMKT--------VGEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFEFNGPLNKYNRETFYVSDPVVGYTDYPFL 1034
            EQV  WK IVD VHAKG + FCQ+ HVGR S++  QP G APIS T+KP++ + R      T+G+    +  PR + T EI Q+V D+R +A NAIEAGFDGIE+HGAHG+LIDQF+KD +NDRTD+YGGSL NRC+F  ++V+AV + IGADRVG+R+SP  +++++ DSNP +LGL + E LNK        + Y H+ +PR           +G + E    +  +R A++GTF+ +GGY RE G +A+A+G ADLV YGRLF++NPDL  R + N PLNKYNR+TFY  DPVVGYTDYPFL
Sbjct:   84 EQVREWKKIVDVVHAKGAVIFCQLWHVGRASHEVYQPAGAAPISSTEKPISNRWRILMPDGTHGI----YPKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGADRVGVRVSPAIDHLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRYVAYGQTEAGRLGSEEEEARLMRTLRNAYQGTFICSGGYTRELGIEAVAQGDADLVSYGRLFISNPDLVMRIKLNAPLNKYNRKTFYTQDPVVGYTDYPFL 384          
BLAST of CV998068 vs. ExPASy Swiss-Prot
Match: OPR3_ARATH (12-oxophytodienoate reductase 3 OS=Arabidopsis thaliana GN=OPR3 PE=1 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 1.630e-84
Identity = 156/303 (51.49%), Postives = 211/303 (69.64%), Query Frame = -1
Query:  180 EQVEAWKPIVDAVHAKGGIFFCQIGHVGRVSNQDIQPNGQAPISCTDKPLTPQ----IRTNGVDIAQFTPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGFLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKY------GILYCHMVEPRMKTVGE--------KSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFEFNGPLNKYNRETFYVSDPVVGYTDYPFL 1034
            EQVEAWK +V+AVHAKGG  FCQ+ HVGR S+   QPNG +PIS T+KP++      +  +G  + ++  PR L   EIP++V D+ L+A NAI AGFDGIE+HGAHG+LIDQF+KD +NDRTDQYGGS+ NRCRF  ++VE V + IGA +VG+R+SP  +++++ DS+P +LGL +   LNK        + Y H+ +PR    G+          E    +  +R A+ GTF+ +GG+++E G +A+ +G ADLV YGRLF+ANPDL  RF+ +G LNKYNR+TFY  DPVVGYTDYPFL
Sbjct:   84 EQVEAWKQVVEAVHAKGGFIFCQLWHVGRASHAVYQPNGGSPISSTNKPISENRWRVLLPDGSHV-KYPKPRALEASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPRYHAYGQTESGRQGSDEEEAKLMKSLRMAYNGTFMSSGGFNKELGMQAVQQGDADLVSYGRLFIANPDLVSRFKIDGELNKYNRKTFYTQDPVVGYTDYPFL 385          
BLAST of CV998068 vs. ExPASy Swiss-Prot
Match: OPRL_SOLLC (12-oxophytodienoate reductase-like protein OS=Solanum lycopersicum GN=OPR2 PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 2.128e-84
Identity = 165/291 (56.70%), Postives = 207/291 (71.13%), Query Frame = -1
Query:  168 EQVEAWKPIVDAVHAKGGIFFCQIGHVGRVSNQDIQPNGQAPISCTDKPLTPQIRTNGVDIAQFTP-PRRLTTDEIPQIVNDFRLAARNAIEAGFDGIELHGAH-GFLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFEFNGPLNKYNRETFYVSDPVVGYTDYPFLDTSS 1034
            EQVEAWKP+V+ VH KGG+FFCQI H GR+S           +S     +     T   D     P P  L +D+IP IVNDFR+AARNAI+AGFDGIE++ +  G+LID+FM DQV+  TD+Y  S+++RCR ALEIVEAV+NEIGAD++GI+LSPF       DSN EAL  YMA  L+K G+LY H++EPR +TV        SLLP+RKAFKGT + +GGY + DG KAI E  ADL+ +GR+FLANPDLP+RFE N PLNKYNR TFY +DP++GYTDYPFL+ +S
Sbjct:   83 EQVEAWKPVVNGVHEKGGVFFCQIWHSGRLS--------VPTVSALFFSIGIGWSTRPDDKVYAKPTPLPLESDKIPCIVNDFRIAARNAIKAGFDGIEINASSGGYLIDEFMNDQVHGWTDEYDESIKDRCRLALEIVEAVANEIGADKIGIKLSPFDG---KKDSNSEALATYMANELSKLGVLYLHVMEPR-ETVN------RSLLPIRKAFKGTLIASGGYGKSDGEKAIDENYADLISFGRMFLANPDLPKRFEVNAPLNKYNRSTFYTNDPIIGYTDYPFLEVAS 355          
BLAST of CV998068 vs. ExPASy Swiss-Prot
Match: OPRL2_ARATH (Putative 12-oxophytodienoate reductase-like protein 2 OS=Arabidopsis thaliana GN=At1g17990 PE=2 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 4.298e-77
Identity = 138/183 (75.41%), Postives = 163/183 (89.07%), Query Frame = -1
Query:  486 EQVEAWKPIVDAVHAKGGIFFCQIGHVGRVSNQDIQPNGQAPISCTDKPLTPQIRTNGVDIAQFTPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGFLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGI 1034
            +QVEAWKPIVDAVH+KGGIFFCQI H GRV +QD QPNG+AP+S TDKPL  +    G    QF PPRRL +DE+P IVNDFR+AARNAIEAGFDG+E+HGAHG+LIDQF+KD+VNDR+DQYGGSLENRCRFALE++EAV NEIG+DRVGIRLSPFA+YMESGDSNPEALGLY+ +++NK+G+
Sbjct:   81 DQVEAWKPIVDAVHSKGGIFFCQIWHGGRVFHQD-QPNGEAPVSSTDKPLMCKNMYGG----QFKPPRRLRSDELPAIVNDFRIAARNAIEAGFDGVEVHGAHGYLIDQFLKDKVNDRSDQYGGSLENRCRFALEVIEAVVNEIGSDRVGIRLSPFADYMESGDSNPEALGLYLVQAMNKHGM 258          
BLAST of CV998068 vs. ExPASy Swiss-Prot
Match: NEMA_ECOLI (N-ethylmaleimide reductase OS=Escherichia coli (strain K12) GN=nemA PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.878e-56
Identity = 130/292 (44.52%), Postives = 164/292 (56.16%), Query Frame = -1
Query:  180 EQVEAWKPIVDAVHAKGGIFFCQIGHVGRVSNQDIQPNGQAPISCTDKPLTPQIRT-----NGVDI-AQFTPPRRLTTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGFLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDS-NPEALGLYMAESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFEFNGPLNKYNRETFYVSDPVVGYTDYPFL 1034
            EQ+ AWK I   VHA+ G    Q+ H GR+S+  +QP GQAP++     L+   RT     NG  I  + + PR L  +EIP IVNDFR A  NA EAGFD +ELH AHG+L+ QF+    N RTDQYGGS+ENR R  LE+V+A   E GADR+GIR+SP   +  + +  N EA  LY+ E L K GI Y HM EP     G +         +R  F G  + AG Y  E     I +G  D V +GR ++ANPDL  R +    LN    E+FY      GYTDYP L
Sbjct:   79 EQIAAWKKITAGVHAENGHMAVQLWHTGRISHASLQPGGQAPVA--PSALSAGTRTSLRDENGQAIRVETSMPRALELEEIPGIVNDFRQAIANAREAGFDLVELHSAHGYLLHQFLSPSSNHRTDQYGGSVENRARLVLEVVDAGIEEWGADRIGIRVSPIGTFQNTDNGPNEEADALYLIEQLGKRGIAYLHMSEP--DWAGGEPYTDAFREKVRARFHGPIIGAGAYTVEKAETLIGKGLIDAVAFGRDWIANPDLVARLQRKAELNPQRAESFY-GGGAEGYTDYPTL 365          
BLAST of CV998068 vs. ExPASy Swiss-Prot
Match: OYEA_SCHPO (Putative NADPH dehydrogenase C5H10.04 OS=Schizosaccharomyces pombe GN=SPAC5H10.04 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 8.467e-41
Identity = 113/299 (37.79%), Postives = 166/299 (55.52%), Query Frame = -1
Query:  183 EQVEAWKPIVDAVHAKGGIFFCQI----GHVGRVSNQDIQPNGQAPIS-CTDKP--LTPQIRT-NGVDIAQFTPPRRLTTDEIPQIVNDFRLAARNAIE-AGFDGIELHGAHGFLIDQFMKDQVNDRTD-QYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKY--GILYCHMVEPRMKTVGEK---SECPHSLLPMRKAFKGTFLVAGGYDREDGNKAIAEGRADLVVYGRLFLANPDLPRRFEFNGPLNKYNRETFYVSDPVVGYTDYPF 1034
            EQ E+W P+V+AVH      F Q     G +      D++   +   S C   P  L   I + + V   +    + ++  +I + + DF  AA  A+  A  DG+E+H  +GFL+D+F+     D+ D +Y GS+ENRCRF LE++EAV+ +IG +RVG R+SPF+ +M+  D     + +Y+   + K    + Y H +EPR    G K   SE   S L  +K +KG F+ AGGYD E   +A A  R  LV +GR F+ANPDL  R + + PLNK++R +FY+     GYTDYPF
Sbjct:   81 EQAESWIPLVEAVHKNKSFLFIQFWPLPGDLKDEYRNDLEKMQKITYSDCPQDPGGLPAGIHSFDAVQGVEVYKKKYMSKRDIQEHIQDFVNAADLAVNIAKADGVEIHQVNGFLLDRFVLGGFGDQCDPEYRGSIENRCRFPLEVLEAVTRKIGQERVGYRISPFSGWMQKIDF--MEVNIYLMSEIAKRFPKLAYIHAIEPRKYWSGHKLVSSEQNTSFL--QKYWKGPFITAGGYDPETAVQA-ANERGVLVAFGRNFIANPDLVFRIKHHIPLNKWDRSSFYLPKTEKGYTDYPF 374          
The following BLAST results are available for this feature:
BLAST of CV998068 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
OPR1_SOLLC2.922e-14281.5312-oxophytodienoate reductase 1 OS=Solanum lycoper... [more]
OPR2_ARATH8.235e-13777.5112-oxophytodienoate reductase 2 OS=Arabidopsis tha... [more]
OPR1_ARATH1.189e-13577.5112-oxophytodienoate reductase 1 OS=Arabidopsis tha... [more]
OPRL1_ARATH1.236e-11675.00Putative 12-oxophytodienoate reductase-like protei... [more]
OPR3_SOLLC2.057e-8753.1112-oxophytodienoate reductase 3 OS=Solanum lycoper... [more]
OPR3_ARATH1.630e-8451.4912-oxophytodienoate reductase 3 OS=Arabidopsis tha... [more]
OPRL_SOLLC2.128e-8456.7012-oxophytodienoate reductase-like protein OS=Sola... [more]
OPRL2_ARATH4.298e-7775.41Putative 12-oxophytodienoate reductase-like protei... [more]
NEMA_ECOLI1.878e-5644.52N-ethylmaleimide reductase OS=Escherichia coli (st... [more]
OYEA_SCHPO8.467e-4137.79Putative NADPH dehydrogenase C5H10.04 OS=Schizosac... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_B-6_T7 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC60_D08_058, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998068 ID=CV998068|Name=CV998068|organism=Citrus sinensis|type=EST|length=1034bp
TTTTTTGATGTGAACATAGGCATAGCCTTGGCCTTACGCCATTACAATTT
TACTGAGATAAACTATACTGGCTTTTACATTCACACGCTACATCAATAAA
AATTCAGAAAACAAGATTAAATCTGAGAGAATGCTTTATCAATCTAATGC
TTTTTCTTGGTAACATAAGAAGAGGTGTCGAGAAAGGGATAATCCGTGTA
ACCAACAACAGGATCGGAAACATAGAATGTTTCTCTGTTGTACTTATTGA
GGGGGCCATTGAACTCAAATCTCCTGGGTAAATCTGGATTAGCCAAGAAC
AAGCGACCATAAACAACAAGATCTGCACGGCCTTCAGCAATAGCTTTGTT
TCCATCTTCCCTGTCATAACCCCCAGCGACAAGAAAAGTACCCTTGAAAG
CCTTTCTCATGGGCAGCAAACTGTGAGGACATTCAGATTTTTCTCCAACT
GTTTTCATCCTCGGCTCAACCATGTGACAATAGAGGATACCGTATTTGTT
CAAGGATTCTGCCATGTAAAGACCTAAAGCTTCTGGGTTAGAGTCCCCTG
ATTCCATATAGTTTGCAAACGGAGATAGTCTTATCCCAACCCTATCTGCC
CCTATTTCATTGGAAACAGCTTCAACTATTTCTAAAGCAAAACGGCAACG
GTTCTCTAAGGATCCTCCATACTGGTCTGTTCGATCATTCACTTGATCCT
TCATAAATTGGTCAATTAGGAAGCCATGTGCACCGTGGAGCTCAATGCCA
TCGAAACCAGCCTCAATTGCATTTCTTGCAGCAAGCCTGAAATCATTCAC
AATTTGAGGGATTTCATCTGTCGTTAGCCGCCTTGGAGGAGTGAATTGTG
CAATATCAACACCATTAGTGCGGATTTGAGGTGTCAATGGCTTGTCTGTA
CAGGAAATTGGAGCTTGACCATTTGGCTGAATATCTTGATTTGAAACCCT
GCCAACGTGCCCAATCTGACAAAAGAAGATCCCACCTTTGGCATGAACAG
CATCTACAATCGGTTTCCATGCTTCAACTTGCTC
back to top