CV998067

Overview
NameCV998067
Unique NameCV998067
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length894
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CV998067 vs. ExPASy Swiss-Prot
Match: C81E1_GLYEC (Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2)

HSP 1 Score: 350.132 bits (897), Expect = 9.717e-96
Identity = 166/274 (60.58%), Postives = 217/274 (79.20%), Query Frame = 3
Query:    6 DFLPILKWIDVGDHKKRILRFSRTTDAFLQGLIDEHRTKKPGSESTNTMIDHMLALQESQPEYYTDQIIKGLILVMLLAGTDTSAVTIEWAMSNLVNNPEVLEKARAELDSKVGQEYLIDEPDLSKLHYLQSVISESLRLYPTAPLLVPHQSSDDCTVGGYHVPRGAILLVNAWAIHRDPKLWNDPDNFRPERFEKGECEAHKLMPFGLGRRACPGSGLAQRVVGLTLGSLIQCFEWLRIDEDKVDMTEGRGITMPKAEPLEVMCRARPIVNNV 827
            DF+P+L+++D  + +KR+   S  TDAFL+GLI+EHRTKK   E  NTMIDH+L LQ+SQPEYYTDQIIKGL L MLLAGTD+SAVT+EW+MSNL+N+PEVL+K + ELD+ VGQ+ L+DE DL KL YL++VI+E+LRLY  APLL+PH +SD+C +GGY VP+  I+L+NAWAIHRDP+LW +   F+PERFEK + E  KL+ FG+GRRACPG GLA R + +TL  LIQCF+W  I+ DK+D+ E  G T+ K  PL+ MC++RP++N V
Sbjct:  227 DFMPLLRFLDFENLEKRLKDISGKTDAFLRGLIEEHRTKK---ERANTMIDHLLNLQDSQPEYYTDQIIKGLALAMLLAGTDSSAVTLEWSMSNLLNHPEVLKKVKDELDTHVGQDRLVDESDLPKLTYLKNVINETLRLYTPAPLLLPHSTSDECNIGGYKVPQDTIVLINAWAIHRDPELWTEATTFKPERFEK-KGELEKLIAFGMGRRACPGEGLAIRAISMTLALLIQCFDWKLINGDKIDLAERDGFTLTKLVPLKAMCKSRPVINKV 496          
BLAST of CV998067 vs. ExPASy Swiss-Prot
Match: C81D1_ARATH (Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 4.082e-94
Identity = 164/274 (59.85%), Postives = 218/274 (79.56%), Query Frame = 3
Query:    6 DFLPILKWIDVGDHKKRILRFSRTTDAFLQGLIDEHRTKKPGSESTNTMIDHMLALQESQPEYYTDQIIKGLILVMLLAGTDTSAVTIEWAMSNLVNNPEVLEKARAELDSKVGQEYLIDEPDLSKLHYLQSVISESLRLYPTAPLLVPHQSSDDCTVGGYHVPRGAILLVNAWAIHRDPKLWNDPDNFRPERFEKGECEAHKLMPFGLGRRACPGSGLAQRVVGLTLGSLIQCFEWLRIDEDKVDMTEGRGITMPKAEPLEVMCRARPIVNNV 827
            D++PIL+      ++ R+ +    TD FLQGLID+ R ++   E+  TMIDH+L LQ+S  EYYTDQIIKG+IL+M++AGT+TSAVT+EWA+SNL+N+P+V+ KAR E+D++VG + LI+E DLS+L YL++++ E+LRL+P  PLLVPH +S+DC +G Y +PRG  LLVNAWAIHRDP  W+DPD+F+PERFEK E EA KL+ FGLGRRACPGSGLAQR+VGL LGSLIQCFEW R+   +VDM EG G T+PKA PL+ +C+ARP ++ +
Sbjct:  233 DYVPILRLFS--SYENRVKKLGEETDKFLQGLIDDKRGQQ---ETGTTMIDHLLVLQKSDIEYYTDQIIKGIILIMVIAGTNTSAVTLEWALSNLLNHPDVISKARDEIDNRVGLDRLIEEADLSELPYLKNIVLETLRLHPATPLLVPHMASEDCKIGSYDMPRGTTLLVNAWAIHRDPNTWDDPDSFKPERFEKEE-EAQKLLAFGLGRRACPGSGLAQRIVGLALGSLIQCFEWERVGNVEVDMKEGVGNTVPKAIPLKAICKARPFLHKI 500          
BLAST of CV998067 vs. ExPASy Swiss-Prot
Match: C81F1_ARATH (Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2)

HSP 1 Score: 316.62 bits (810), Expect = 1.191e-85
Identity = 149/277 (53.79%), Postives = 204/277 (73.65%), Query Frame = 3
Query:    6 DFLPILKWIDVGDHKKRILRFSRTTDAFLQGLIDEHRTKKPGSESTNTMIDHMLALQESQPEYYTDQIIKGLILVMLLAGTDTSAVTIEWAMSNLVNNPEVLEKARAELDSKVGQEYLIDEPDLSKLHYLQSVISESLRLYPTAPLLVPHQSSDDCTVGGYHVPRGAILLVNAWAIHRDPKLWNDPDNFRPERFEKG---ECEAHKLMPFGLGRRACPGSGLAQRVVGLTLGSLIQCFEWLRIDEDKVDMTEGRGITMPKAEPLEVMCRARPIVNNV 827
            D+LPILK       +K +    ++ D  LQ L+DE R  K G    NTM++H+++LQ+ QPEYYTD IIKGL++ M+LAGT+TSAVT+EWAM+NL+ NPEVLEKAR+E+D K+G++ LIDE D++ L YLQ+V+SE+ RL+P AP L+P   +DD  +GGY VPR  I++VNAWAIHRDP++W +P+ F P+R+  G   +   +KLMPFG GRR CPG+GL QR+V L LGSLIQCFEW  +  +++DM+E  G+ M K +PL  MCR RPI++ +
Sbjct:  227 DYLPILKLFG-NKFEKEVKAIGKSMDDILQRLLDECRRDKEG----NTMVNHLISLQQQQPEYYTDVIIKGLMMSMMLAGTETSAVTLEWAMANLLRNPEVLEKARSEIDEKIGKDRLIDESDIAVLPYLQNVVSETFRLFPVAPFLIPRSPTDDMKIGGYDVPRDTIVMVNAWAIHRDPEIWEEPEKFNPDRYNDGCGSDYYVYKLMPFGNGRRTCPGAGLGQRIVTLALGSLIQCFEWENVKGEEMDMSESTGLGMRKMDPLRAMCRPRPIMSKL 498          
BLAST of CV998067 vs. ExPASy Swiss-Prot
Match: C82A3_SOYBN (Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 7.527e-56
Identity = 116/283 (40.99%), Postives = 171/283 (60.42%), Query Frame = 3
Query:    6 DFLPILKWIDVGDHKKRILRFSRTTDAFLQGLIDEHRTKK---PGSESTNTMIDHML-ALQESQ-PEYYTDQIIKGLILVMLLAGTDTSAVTIEWAMSNLVNNPEVLEKARAELDSKVGQEYLIDEPDLSKLHYLQSVISESLRLYPTAPLLVPHQSSDDCTVGGYHVPRGAILLVNAWAIHRDPKLWNDPDNFRPERF----EKGECEAH--KLMPFGLGRRACPGSGLAQRVVGLTLGSLIQCFEWLRIDEDKVDMTEGRGITMPKAEPLEVMCRARPIVN 821
            D +P L+W+D+G H+K +   ++  D  L   ++EHR KK      ES    +D M+ AL  +Q   +  D I K   L ++L GTD++AVT+ WA+S L+ NP  L KA+ E+D ++G++  I E D+SKL YLQ+++ E+LRLYP AP   P + +++C +GGYH+ +G  L+ N W IHRDP +W+DP  F+PERF    +  +   H  +L+PFG GRR C G  L   +V  TL +L+  F+ L    + VDMTE  G T  KA PLE++ + R   N
Sbjct:  240 DGVPCLRWLDLGGHEKAMKANAKEVDKLLSEWLEEHRQKKLLGENVESDRDFMDVMISALNGAQIGAFDADTICKATSLELILGGTDSTAVTLTWALSLLLRNPLALGKAKEEIDMQIGKDEYIRESDISKLVYLQAIVKETLRLYPPAPFSSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSVWSDPLEFKPERFLTTHKDVDLRGHNFELLPFGSGRRVCAGMSLGLNMVHFTLANLLHSFDILNPSAEPVDMTEFFGFTNTKATPLEILVKPRQSPN 522          
BLAST of CV998067 vs. ExPASy Swiss-Prot
Match: C82A1_PEA (Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2)

HSP 1 Score: 213.001 bits (541), Expect = 1.854e-54
Identity = 111/279 (39.78%), Postives = 165/279 (59.14%), Query Frame = 3
Query:    6 DFLPILKWIDVGDHKKRILRFSRTTDAFLQGLIDEHRTKKP-GSEST----NTMIDHMLALQESQP--EYYTDQIIKGLILVMLLAGTDTSAVTIEWAMSNLVNNPEVLEKARAELDSKVGQEYLIDEPDLSKLHYLQSVISESLRLYPTAPLLVPHQSSDDCTVGGYHVPRGAILLVNAWAIHRDPKLWNDPDNFRPERFEKGECEA------HKLMPFGLGRRACPGSGLAQRVVGLTLGSLIQCFEWLRIDEDKVDMTEGRGITMPKAEPLEVMCR 803
            D +P LKW+D+G H+K + + ++  D  L   ++EHR KK  GSE         +D ML + + +P   +  D IIK   L ++L G+DT+A T+ WAM  L+ +P VLEK + EL++ +G+E  ++E D++KL YL ++I E+LRLYP AP   P + ++DCT+GGYH+ +G  L+ N W IHRDP +W DP  F+PERF     +        +L+PFG GRR C G  L   +V   L + +  FE L    + +D+TE       KA PLEV+ +
Sbjct:  255 DGVPFLKWLDLGGHEKEMKKCAKKFDVMLNEWLEEHREKKGLGSEDKVVGERDFMDAMLLVLKDKPIEGFDVDTIIKATTLELILGGSDTTAGTLTWAMCLLLKHPHVLEKLKEELNTYIGKERCVNESDINKLVYLHAIIKETLRLYPPAPFSSPREFTEDCTIGGYHIKKGTRLMPNLWKIHRDPSVWPDPLEFKPERFLSTHKDVDVRGQNFELLPFGSGRRMCAGMSLGLHMVHYILANFLHSFEILNPSPESIDVTEVLEFVTTKATPLEVLVK 533          
BLAST of CV998067 vs. ExPASy Swiss-Prot
Match: C93A3_SOYBN (Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 7.045e-54
Identity = 121/277 (43.68%), Postives = 165/277 (59.57%), Query Frame = 3
Query:    6 DFLPILKWIDVGDHKKRILRFSRTTDAFLQGLI----DEHRTKKP--GSESTNTMIDHMLALQESQPEYY--TDQIIKGLILVMLLAGTDTSAVTIEWAMSNLVNNPEVLEKARAELDSKVGQEYLIDEPDLSKLHYLQSVISESLRLYPTAPLLVPHQSSDDCTVGGYHVPRGAILLVNAWAIHRDPKLWNDPDNFRPERF-EKGECEA------HKLMPFGLGRRACPGSGLAQRVVGLTLGSLIQCFEW-LRIDEDKVDMTEGRGITMPKAEPL 788
            DF+  LK  D+    KR+ +     D  L  +I    +E R K    G      M+D +  + E +        + IK  IL +L+AGTDTSAVT+EWAM+ L+NNP VLEKAR E+D+ VG+  +++E D++ L YLQ ++ E+LRL+P  PLL   +SS    V GY +P    L VN WAI RDP  W +P  FRPERF E G+ +       + L+PFG GRRACPG+ LA +VV + L  LIQCF+W +  D  KV+M E  GIT+P+A P+
Sbjct:  221 DFVSFLKRFDLQGFNKRLEKIRDCFDTVLDRIIKQREEERRNKNETVGKREFKDMLDVLFDISEDESSEIKLNKENIKAFILDILIAGTDTSAVTMEWAMAELINNPGVLEKARQEMDAVVGKSRIVEESDIANLPYLQGIVRETLRLHPAGPLLF-RESSRRAVVCGYDIPAKTRLFVNVWAIGRDPNHWENPLEFRPERFVENGKSQLDVRGQHYHLLPFGSGRRACPGTSLALQVVHVNLAVLIQCFQWKVDCDNGKVNMEEKAGITLPRAHPI 496          
BLAST of CV998067 vs. ExPASy Swiss-Prot
Match: C82A2_SOYBN (Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.202e-53
Identity = 115/278 (41.37%), Postives = 163/278 (58.63%), Query Frame = 3
Query:    6 DFLPILKWIDVGDHKKRILRFSRTTDAFLQGLIDEHRTKKPGSESTNTMIDHMLALQESQP--EYYTDQIIKGLILVMLLAGTDTSAVTIEWAMSNLVNNPEVLEKARAELDSKVGQEYLIDEPDLSKLHYLQSVISESLRLYPTAPLLVPHQSSDDCTVGGYHVPRGAILLVNAWAIHRDPKLWNDPDNFRPERF--------EKGECEAHKLMPFGLGRRACPGSGLAQRVVGLTLGSLIQCFEWLRIDEDKVDMTEGRGITMPKAEPLEVMCRAR 809
            D +P L+W D G ++  +    +  D  +   +DEHR K+   E+   ++  +L+L E +       D +IK  +L ++ AGT+ S  T+ WA S ++NNP VLEK +AELD +VG+E  I E DLSKL YLQ+V+ E+LRLYP APL  P +  +DCT+GGY V +G  L+ N   IH D  +W++P  F+PERF         KG  +  +L+PFG GRR CPG  L  + V LTL S +  FE L    + +DMTE    T  KA PLE++ + R
Sbjct:  238 DAIPYLRWFDFGGYENDMRETGKELDEIIGEWLDEHRQKRKMGENVQDLMSVLLSLLEGKTIEGMNVDIVIKSFVLTVIQAGTEASITTLIWATSLILNNPSVLEKLKAELDIQVGKERYICESDLSKLTYLQAVVKETLRLYPPAPLSRPREFEEDCTIGGYTVKKGTRLITNLSKIHTDHNVWSNPLEFKPERFLTTDKDIDMKG--QHFQLLPFGGGRRICPGINLGLQTVRLTLASFLHSFEILNPSTEPLDMTEVFRATNTKATPLEILIKPR 513          
BLAST of CV998067 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.017e-52
Identity = 108/283 (38.16%), Postives = 170/283 (60.07%), Query Frame = 3
Query:    6 DFLPILKWIDVGDHKKRILRFSRTTDAFLQGLIDEHRTKKPGSESTNTMIDHMLALQESQPE----YYTDQIIKGLILVMLLAGTDTSAVTIEWAMSNLVNNPEVLEKARAELDSKVGQEYLIDEPDLSKLHYLQSVISESLRLYPTAPLLVPHQSSDDCTVGGYHVPRGAILLVNAWAIHRDPKLWNDPDNFRPERFEKG--------ECEAHKLMPFGLGRRACPGSGLAQRVVGLTLGSLIQCFEWL---RIDEDKVDMTEGRGITMPKAEPLEVMCRAR 809
            DF+P L W+D+     ++ R  +  DAFL  ++ EH       + T+ M+  +++L+ +  +      TD  IK L+L M  AGTDTSA T++WA++ L+ +P+++ KA+ ELD  VG++  ++E D+++L YLQ+VI E+ RL+P  PL +PH +S+ C + GYH+P+G+ LL N WAI RDP  W+DP  F+PERF  G        +    +L+PFG GRR C G  L  R +     +L+Q F+W     +  +K++M E  G+T+ +A PL V  + R
Sbjct:  221 DFVPSLDWLDLQGVAGKMKRLHKRFDAFLSSILKEHEMNGQDQKHTD-MLSTLISLKGTDLDGDGGSLTDTEIKALLLNMFTAGTDTSASTVDWAIAELIRHPDIMVKAQEELDIVVGRDRPVNESDIAQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKPERFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQFLTATLVQGFDWELAGGVTPEKLNMEESYGLTLQRAVPLVVHPKPR 502          
BLAST of CV998067 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.735e-52
Identity = 106/283 (37.46%), Postives = 172/283 (60.78%), Query Frame = 3
Query:    6 DFLPILKWIDVGDHKKRILRFSRTTDAFLQGLIDEHRTKKPGSESTNTMIDHMLALQESQPEY----YTDQIIKGLILVMLLAGTDTSAVTIEWAMSNLVNNPEVLEKARAELDSKVGQEYLIDEPDLSKLHYLQSVISESLRLYPTAPLLVPHQSSDDCTVGGYHVPRGAILLVNAWAIHRDPKLWNDPDNFRPERF----EKGECEAH----KLMPFGLGRRACPGSGLAQRVVGLTLGSLIQCFEWLRID---EDKVDMTEGRGITMPKAEPLEVMCRAR 809
            DF+P L W+D+     ++ +     DAFL  +++EH+ K  G      ++  +++L+    +      TD  IK L+L + +AGTDTS+ T+EWA++ L+ NP++L +A+ E+D  VG++ L+ E DL++L YL++++ E+ RL+P+ PL +P  +S+ C + GY +P+G+ LL+N WAI RDP  W DP  FRPERF    EK + +      +++PFG GRR C G  L  R+V L + +LI  F W  +     + ++M E  G+T+ +A+PL V  R R
Sbjct:  224 DFIPQLNWLDIQGVAAKMKKLHARFDAFLTDILEEHKGKIFGE--MKDLLSTLISLKNDDADNDGGKLTDTEIKALLLNLFVAGTDTSSSTVEWAIAELIRNPKILAQAQQEIDKVVGRDRLVGELDLAQLTYLEAIVKETFRLHPSTPLSLPRIASESCEINGYFIPKGSTLLLNVWAIARDPNAWADPLEFRPERFLPGGEKPKVDVRGNDFEVIPFGAGRRICAGMNLGIRMVQLMIATLIHAFNWDLVSGQLPEMLNMEEAYGLTLQRADPLVVHPRPR 504          
BLAST of CV998067 vs. ExPASy Swiss-Prot
Match: C93A2_SOYBN (Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 2.960e-52
Identity = 121/289 (41.87%), Postives = 172/289 (59.52%), Query Frame = 3
Query:    6 DFLPILKWIDVGDHKKRI----LRFSRTTDAFLQGLIDEHRTKKP--GSESTNTMIDHMLALQE--SQPEYYTDQIIKGLILVMLLAGTDTSAVTIEWAMSNLVNNPEVLEKARAELDSKVGQEYLIDEPDLSKLHYLQSVISESLRLYPTAPLLVPHQSSDDCTVGGYHVPRGAILLVNAWAIHRDPKLWNDPDNFRPER-FEKGECEA------HKLMPFGLGRRACPGSGLAQRVVGLTLGSLIQCFEWLRID--EDKVDMTEGRGITMPKAEPLEVMCRARPIVN 821
            DF+  LK  D+    KRI    +RF    D  ++   +E R  K   G+     ++D +L + E  S     T + IK  I+ + +AGTDTSA T+EWAM+ L+NNP VLEKAR E+D+ VG   +I+E D+  L YLQ+++ E+LR++P  PL+V  +SS    V GY +P    L VN WAI RDP  W +P  FRPER FE G+ +       +  +PFG GRR+CPG+ LA ++V + L  +IQCF+W + D   +KVDM E  GIT+P+A P  ++C   P +N
Sbjct:  213 DFIWFLKPFDLQGFNKRIRKTRIRFDAVLDRIIKQREEERRNNKEIGGTRQFKDILDVLLDIGEDDSSEIKLTKENIKAFIMDIFVAGTDTSAATMEWAMAELINNPCVLEKARQEIDAVVGNSRIIEESDIVNLPYLQAIVRETLRIHPGGPLIV-RESSKSVVVCGYEIPAKTRLFVNVWAIGRDPNHWENPFEFRPERFFENGQSQLDVRGQHYHFIPFGSGRRSCPGTSLALQIVHVNLAIMIQCFQW-KFDNGNNKVDMEEKSGITLPRAHP--IICVPVPRLN 497          
The following BLAST results are available for this feature:
BLAST of CV998067 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
C81E1_GLYEC9.717e-9660.58Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata ... [more]
C81D1_ARATH4.082e-9459.85Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CY... [more]
C81F1_ARATH1.191e-8553.79Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CY... [more]
C82A3_SOYBN7.527e-5640.99Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=... [more]
C82A1_PEA1.854e-5439.78Cytochrome P450 82A1 (Fragment) OS=Pisum sativum G... [more]
C93A3_SOYBN7.045e-5443.68Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=... [more]
C82A2_SOYBN1.202e-5341.37Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=... [more]
F3PH_ARATH1.017e-5238.16Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
F3PH_PETHY1.735e-5237.46Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]
C93A2_SOYBN2.960e-5241.87Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_B-6_T3 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC30_F04_022, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998067 ID=CV998067|Name=CV998067|organism=Citrus sinensis|type=EST|length=894bp
CAGAAGATTTCTTGCCGATCTTGAAGTGGATCGACGTTGGTGATCATAAG
AAGAGGATTTTGAGGTTTAGTAGAACTACTGATGCGTTTTTGCAAGGCTT
GATTGATGAGCACAGAACTAAGAAGCCAGGTTCTGAGAGCACCAATACCA
TGATTGATCATATGCTGGCTTTGCAAGAGTCTCAGCCTGAATACTACACT
GATCAAATCATCAAAGGCCTTATACTGGTGATGCTGCTAGCTGGGACCGA
CACATCAGCAGTGACAATAGAATGGGCGATGTCCAATTTGGTCAATAATC
CAGAGGTACTAGAAAAAGCCAGAGCGGAACTAGACAGTAAAGTTGGCCAA
GAGTACTTGATCGACGAGCCTGATCTTTCCAAACTACATTATCTTCAGAG
TGTTATATCAGAGAGCCTTCGACTGTATCCAACAGCGCCACTTCTAGTAC
CTCACCAATCATCCGACGACTGCACTGTAGGAGGATACCATGTTCCACGT
GGCGCAATCTTATTGGTAAATGCGTGGGCTATTCACAGGGACCCTAAGTT
GTGGAATGATCCAGACAATTTTAGACCAGAAAGGTTCGAGAAGGGAGAAT
GTGAGGCCCACAAGCTAATGCCATTCGGGTTAGGAAGGCGAGCGTGTCCT
GGATCGGGTTTGGCCCAACGTGTCGTGGGCTTAACTTTGGGCTCGTTGAT
TCAATGTTTCGAGTGGCTGAGAATTGATGAAGACAAGGTTGATATGACCG
AAGGGAGAGGAATCACCATGCCTAAAGCCGAGCCATTAGAGGTTATGTGC
AGAGCTCGCCCCATCGTGAACAATGTTTCGGAACTCTTTGACTAAATCAG
AGTGGTTATTTCTTTTATTTCTCTTTTGGCAATGTTGTGCTCAT
back to top