CV998059

Overview
NameCV998059
Unique NameCV998059
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length968
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2871 contig Csv1_Contig2871:213..1180. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998059 vs. ExPASy Swiss-Prot
Match: PALY_VITVI (Phenylalanine ammonia-lyase (Fragment) OS=Vitis vinifera GN=PAL PE=2 SV=1)

HSP 1 Score: 460.685 bits (1184), Expect = 5.757e-129
Identity = 226/265 (85.28%), Postives = 245/265 (92.45%), Query Frame = -1
Query:  171 RNPSLDMGFKGAEIAMASYVSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTVGASGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTANSSIFQKIAAFEEELKTVLPKEVENARQTVENGSPTIPNRIKECRSYPLYRFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 965
            RNPSLD GFKGAEIAMASY SELQFLANPVTNHV+SAEQHNQDVNSLGLISSRKTAEAVDILKLMS+T+LVALCQAIDLRHLEENLK TVK TVS VAKK LT+GA+GELHPSRFCEKDLLK  DREHVFAYIDDPCSATYPLMQK+RQVLVEHALNNGE+EK  ++SIFQKI AFEEELK VLPKEVE+AR  VE+G+P+IPNRIKECRSYPLY+FVRE LG+  LTGEKV SPGE+FDKVFTAMC+GKIIDP+L+CL  WNGA
Sbjct:  147 RNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVESAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTYLVALCQAIDLRHLEENLKSTVKKTVSHVAKKTLTIGANGELHPSRFCEKDLLKVVDREHVFAYIDDPCSATYPLMQKVRQVLVEHALNNGESEKNGSTSIFQKIGAFEEELKAVLPKEVESARDGVESGNPSIPNRIKECRSYPLYKFVREELGTGLLTGEKVRSPGEDFDKVFTAMCEGKIIDPLLDCLSAWNGA 411          
BLAST of CV998059 vs. ExPASy Swiss-Prot
Match: PAL1_POPKI (Phenylalanine ammonia-lyase G1 OS=Populus kitakamiensis GN=PALG1 PE=3 SV=1)

HSP 1 Score: 456.447 bits (1173), Expect = 1.086e-127
Identity = 222/266 (83.46%), Postives = 246/266 (92.48%), Query Frame = -1
Query:  171 GRNPSLDMGFKGAEIAMASYVSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTVGASGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTANSSIFQKIAAFEEELKTVLPKEVENARQTVENGSPTIPNRIKECRSYPLYRFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 968
            GRNPSLD GFKGAEIAMASY SELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMS+TFLV LCQA+DLRH+EENLK+TVKNTVSQVAK+VLT+G +GELHPSR CEKDLLK  D+EHVFAYIDDPCSATYPLMQKLRQVLVEHAL NGE E  + +SIFQKI +FEEELKT+LPKEVE+AR  VENG+P +PNRIKECRSYPLY+FVRE LG++ LTGEKV SPGE+FDKVFTA+C GK++DP+LECL+EWNGA
Sbjct:  412 GRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSTTFLVGLCQAVDLRHIEENLKNTVKNTVSQVAKRVLTMGFNGELHPSRLCEKDLLKLVDKEHVFAYIDDPCSATYPLMQKLRQVLVEHALVNGERETNSTTSIFQKIRSFEEELKTLLPKEVESARLEVENGNPVVPNRIKECRSYPLYKFVREELGTSLLTGEKVKSPGEDFDKVFTAICAGKLMDPLLECLKEWNGA 677          
BLAST of CV998059 vs. ExPASy Swiss-Prot
Match: PAL1_PRUAV (Phenylalanine ammonia-lyase 1 OS=Prunus avium GN=PAL1 PE=2 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 7.037e-127
Identity = 223/266 (83.83%), Postives = 244/266 (91.73%), Query Frame = -1
Query:  171 GRNPSLDMGFKGAEIAMASYVSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTVGASGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTANSSIFQKIAAFEEELKTVLPKEVENARQTVENGSPTIPNRIKECRSYPLYRFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 968
            GRNPSLD GFKGAEIAMASY SELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENL++TVKNTVSQVAK+ LT G +GELHPSRFCEKDLLK  DRE+VFAYIDDPCSATYPLMQKLRQVLVEHAL NGENEK A++SIFQKI AFEEELK +LPKEV++AR  +++GS  +PNRI ECRSYPLY+FVRE LG+ +LTGEKV SPGEE DKVFTA+C+GKIIDP+L+CL  WNGA
Sbjct:  447 GRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLRNTVKNTVSQVAKRTLTTGVNGELHPSRFCEKDLLKVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALTNGENEKNASTSIFQKIVAFEEELKVLLPKEVDSARAALDSGSAGVPNRITECRSYPLYKFVREELGAEYLTGEKVRSPGEECDKVFTAICEGKIIDPILDCLEGWNGA 712          
BLAST of CV998059 vs. ExPASy Swiss-Prot
Match: PALY_CAMSI (Phenylalanine ammonia-lyase OS=Camellia sinensis GN=PAL PE=2 SV=1)

HSP 1 Score: 452.981 bits (1164), Expect = 1.200e-126
Identity = 217/266 (81.58%), Postives = 247/266 (92.86%), Query Frame = -1
Query:  171 GRNPSLDMGFKGAEIAMASYVSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTVGASGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTANSSIFQKIAAFEEELKTVLPKEVENARQTVENGSPTIPNRIKECRSYPLYRFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 968
            GRNPSLD GFKGAEIAMA+Y SELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSST+LVALCQA+DLRH EENL++TVK+TVSQVAK+VLT+G +GELHPSRFCEKDLL+  DRE++FAYIDDPCSATYPLMQKLRQVLVEHAL NGE+EK  ++SIFQKI AFEEE+KT+LPKEVE+ R  +ENG+  IPNRIKECRSYPLY+FVRE LG+  LTGEKV SPGEEFDKVFTA+C+G++IDP+++CL+EWNGA
Sbjct:  444 GRNPSLDYGFKGAEIAMAAYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTYLVALCQAVDLRHFEENLRNTVKSTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGESEKNLSTSIFQKIRAFEEEIKTLLPKEVESTRAAIENGNSAIPNRIKECRSYPLYKFVREELGTELLTGEKVRSPGEEFDKVFTALCKGEMIDPLMDCLKEWNGA 709          
BLAST of CV998059 vs. ExPASy Swiss-Prot
Match: PALY_CITLI (Phenylalanine ammonia-lyase OS=Citrus limon GN=PAL6 PE=2 SV=1)

HSP 1 Score: 452.595 bits (1163), Expect = 1.568e-126
Identity = 222/266 (83.46%), Postives = 246/266 (92.48%), Query Frame = -1
Query:  171 GRNPSLDMGFKGAEIAMASYVSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTVGASGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTANSSIFQKIAAFEEELKTVLPKEVENARQTVENGSPTIPNRIKECRSYPLYRFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 968
            GRNPSLD GFKGAEIAMASY SELQFLANPVTNHVQSAEQHNQDVNSLGL SSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLK+TVKNTVSQVAK+VLT+G +GELHPSRFCEKDL+K  DRE+VFAYIDDPCSA+ PLMQKLRQVLV+HAL+NG+ EK + +SIFQKI AFE+ELKT+LPKEVE AR  +E+G+  IPNRIKECRSYPLY+ VRE +G++ LTGEKV SPGEEFDKVFTAMC+GK+IDPMLECL+EWNGA
Sbjct:  450 GRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLNSSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKNTVKNTVSQVAKRVLTMGVNGELHPSRFCEKDLIKVVDREYVFAYIDDPCSASSPLMQKLRQVLVDHALDNGDREKNSTTSIFQKIGAFEDELKTLLPKEVEIARTELESGNAAIPNRIKECRSYPLYKIVREDIGTSLLTGEKVRSPGEEFDKVFTAMCEGKLIDPMLECLKEWNGA 715          
BLAST of CV998059 vs. ExPASy Swiss-Prot
Match: PALY_PERAE (Phenylalanine ammonia-lyase OS=Persea americana GN=PAL PE=2 SV=1)

HSP 1 Score: 451.825 bits (1161), Expect = 2.674e-126
Identity = 223/266 (83.83%), Postives = 243/266 (91.35%), Query Frame = -1
Query:  171 GRNPSLDMGFKGAEIAMASYVSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTVGASGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTANSSIFQKIAAFEEELKTVLPKEVENARQTVENGSPTIPNRIKECRSYPLYRFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 968
            GRNPSLD GFKGAEIAMA+Y SELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAV+ILKLMSSTFLV LCQAIDLRHLEENLK TVKNTVSQVAK+VLT+G +GELHPSRFCEKDL+K  D EH+FAYIDDPCS TYPLMQKLRQVLVEHAL NGE EK +++SIFQKI AFEEELKT LPKEVE+AR  +E G+  IPNRIKECRSYPLY+FVRE L ++ LTGEKV SPGEEFDKVF+A+CQGK+IDP+LECLREWNGA
Sbjct:  350 GRNPSLDYGFKGAEIAMAAYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSSTFLVGLCQAIDLRHLEENLKSTVKNTVSQVAKRVLTIGVNGELHPSRFCEKDLIKVVDGEHLFAYIDDPCSCTYPLMQKLRQVLVEHALINGEKEKDSSTSIFQKIGAFEEELKTHLPKEVESARIELERGNSAIPNRIKECRSYPLYKFVREELKTSLLTGEKVRSPGEEFDKVFSAICQGKVIDPLLECLREWNGA 615          
BLAST of CV998059 vs. ExPASy Swiss-Prot
Match: PAL1_DAUCA (Phenylalanine ammonia-lyase 1 OS=Daucus carota GN=PAL1 PE=3 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 3.493e-126
Identity = 221/266 (83.08%), Postives = 243/266 (91.35%), Query Frame = -1
Query:  171 GRNPSLDMGFKGAEIAMASYVSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTVGASGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTANSSIFQKIAAFEEELKTVLPKEVENARQTVENGSPTIPNRIKECRSYPLYRFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 968
            GRNPSLD GFKGAEIAMASY SELQFL NPVTNHVQSAEQHNQDVNSLGLISSRKTAEAV+ILKLMS+TFLV LCQA+DLRHLEENLK TVKNTVSQVAKKVLT+G +GELHPSRFCE DLL+  DRE++FAYIDDPCSATYPLMQKLRQVLVEHAL NGE EK  ++SIFQKIAAFE+ELK +LPKEVE+AR  VE+G+P IPNRIKECRSYPLY+F+RE LG+ +LTGEKVTSPGEEFDKVFTAM +G+IIDP+L CL  WNGA
Sbjct:  438 GRNPSLDYGFKGAEIAMASYCSELQFLGNPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSTTFLVGLCQAVDLRHLEENLKSTVKNTVSQVAKKVLTMGVNGELHPSRFCELDLLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGETEKNLSTSIFQKIAAFEDELKALLPKEVESARAVVESGNPAIPNRIKECRSYPLYKFIREELGTVYLTGEKVTSPGEEFDKVFTAMSKGEIIDPLLACLESWNGA 703          
BLAST of CV998059 vs. ExPASy Swiss-Prot
Match: PAL3_PETCR (Phenylalanine ammonia-lyase 3 OS=Petroselinum crispum GN=PAL3 PE=2 SV=1)

HSP 1 Score: 449.514 bits (1155), Expect = 1.327e-125
Identity = 218/266 (81.95%), Postives = 244/266 (91.73%), Query Frame = -1
Query:  171 GRNPSLDMGFKGAEIAMASYVSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTVGASGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTANSSIFQKIAAFEEELKTVLPKEVENARQTVENGSPTIPNRIKECRSYPLYRFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 968
            GRNPSLD GFKGAEIAMASY SELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKT+EAV+ILKLMS+TFLV LCQAIDLRHLEENLK TVKNTVSQVAK+VLT+G +GELHPSRFCEKDLL+  DRE++FAYIDDPCSATYPLMQKLR+ LVEHALNNG+ E+  ++SIFQKIAAFE+ELK +LPKEVE AR  +E+G+P IPNRIKECRSYPLY+FVRE LG+ +LTGEKV SPGEEF+KVFTAM +G+IIDP+LECL  WNGA
Sbjct:  448 GRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTVKNTVSQVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAYIDDPCSATYPLMQKLRETLVEHALNNGDKERNLSTSIFQKIAAFEDELKALLPKEVETARAALESGNPAIPNRIKECRSYPLYKFVREELGTEYLTGEKVRSPGEEFEKVFTAMSKGEIIDPLLECLESWNGA 713          
BLAST of CV998059 vs. ExPASy Swiss-Prot
Match: PAL3_TOBAC (Phenylalanine ammonia-lyase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 5.043e-125
Identity = 222/266 (83.46%), Postives = 241/266 (90.60%), Query Frame = -1
Query:  171 GRNPSLDMGFKGAEIAMASYVSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTVGASGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTANSSIFQKIAAFEEELKTVLPKEVENARQTVENGSPTIPNRIKECRSYPLYRFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 968
            GRNPSLD GFKG+EIAMASY SELQFLANPVTNHVQSAEQHNQDVNSLGLIS+RKTAEAVDILKLMSST+LVALCQAIDLRHLEENL++ VKNTVSQVAK+ LT+GA+GELHPSRFCEKDLL+  DRE+VF Y DD CSA YPLMQKLRQVLV+HAL NGENEK ANSSIFQKI AFE ELK VLPKEVE+AR ++ENG+P I NRIKECRSYPLYRFVRE LG+  LTGEKV SPGEE DKVFTAMC G+IID +LECL+EWNGA
Sbjct:  442 GRNPSLDYGFKGSEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLRNAVKNTVSQVAKRTLTMGANGELHPSRFCEKDLLRVVDREYVFRYADDACSANYPLMQKLRQVLVDHALENGENEKNANSSIFQKILAFEGELKAVLPKEVESARISLENGNPAIANRIKECRSYPLYRFVREELGAELLTGEKVRSPGEECDKVFTAMCNGQIIDSLLECLKEWNGA 707          
BLAST of CV998059 vs. ExPASy Swiss-Prot
Match: PAL1_TOBAC (Phenylalanine ammonia-lyase OS=Nicotiana tabacum GN=TPA1 PE=2 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 8.603e-125
Identity = 218/265 (82.26%), Postives = 241/265 (90.94%), Query Frame = -1
Query:  171 RNPSLDMGFKGAEIAMASYVSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAVDILKLMSSTFLVALCQAIDLRHLEENLKHTVKNTVSQVAKKVLTVGASGELHPSRFCEKDLLKAADREHVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKTANSSIFQKIAAFEEELKTVLPKEVENARQTVENGSPTIPNRIKECRSYPLYRFVREGLGSNFLTGEKVTSPGEEFDKVFTAMCQGKIIDPMLECLREWNGA 965
            RNPSLD GFKGAEIAMASY SELQFLANPVTNHVQSAEQHNQDVNSLGLIS+RKTAEAVDILKLMSST+LVALCQAIDLRHLEENLK+ VKNTVSQVAK+ LT+GA+GELHP+RFCEK+LL+  DRE++FAY DDPCS  YPLMQKLRQVLV+HA+NNGE+EK  NSSIFQKI AFE+ELK VLPKEVE+AR  +E+G+P IPNRI ECRSYPLYRFVR+ LG+  LTGEKV SPGEE DKVFTAMC G+IIDPMLECL+ WNGA
Sbjct:  446 RNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISARKTAEAVDILKLMSSTYLVALCQAIDLRHLEENLKNAVKNTVSQVAKRTLTMGANGELHPARFCEKELLRIVDREYLFAYADDPCSCNYPLMQKLRQVLVDHAMNNGESEKNVNSSIFQKIGAFEDELKAVLPKEVESARAALESGNPAIPNRITECRSYPLYRFVRKELGTELLTGEKVRSPGEECDKVFTAMCNGQIIDPMLECLKSWNGA 710          
The following BLAST results are available for this feature:
BLAST of CV998059 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 53
Match NameE-valueIdentityDescription
PALY_VITVI5.757e-12985.28Phenylalanine ammonia-lyase (Fragment) OS=Vitis vi... [more]
PAL1_POPKI1.086e-12783.46Phenylalanine ammonia-lyase G1 OS=Populus kitakami... [more]
PAL1_PRUAV7.037e-12783.83Phenylalanine ammonia-lyase 1 OS=Prunus avium GN=P... [more]
PALY_CAMSI1.200e-12681.58Phenylalanine ammonia-lyase OS=Camellia sinensis G... [more]
PALY_CITLI1.568e-12683.46Phenylalanine ammonia-lyase OS=Citrus limon GN=PAL... [more]
PALY_PERAE2.674e-12683.83Phenylalanine ammonia-lyase OS=Persea americana GN... [more]
PAL1_DAUCA3.493e-12683.08Phenylalanine ammonia-lyase 1 OS=Daucus carota GN=... [more]
PAL3_PETCR1.327e-12581.95Phenylalanine ammonia-lyase 3 OS=Petroselinum cris... [more]
PAL3_TOBAC5.043e-12583.46Phenylalanine ammonia-lyase OS=Nicotiana tabacum P... [more]
PAL1_TOBAC8.603e-12582.26Phenylalanine ammonia-lyase OS=Nicotiana tabacum G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_B-1_T7 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC55_G07_051, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998059 ID=CV998059|Name=CV998059|organism=Citrus sinensis|type=EST|length=968bp
AGGAAATAAGTCTTATAACCTTAAATGAAAAAACCAATAGAAGTGATTGA
AATATTACAGATGGATTTGTACCACTGACTCGCATGGGCAAATTCTATGA
ACACAAGAACACAAGGGATTGAAGACCATGTTATTAAACAAAATAAAAAC
AACTAACAAATTGGAAGAGGGGCGCCATTCCATTCCCTGAGACATTCCAG
CATTGGATCAATGATCTTGCCCTGGCACATTGCTGTAAAAACTTTGTCAA
ATTCCTCGCCGGGCGATGTAACTTTTTCCCCTGTTAGAAAATTAGACCCG
AGCCCCTCCCTCACGAACCTGTACAACGGGTAAGACCTGCATTCTTTGAT
CCTGTTGGGAATTGTTGGACTTCCATTCTCAACAGTCTGCCTGGCATTCT
CAACTTCTTTCGGCAAAACGGTTTTCAATTCCTCCTCAAAGGCTGCAATC
TTCTGGAAGATTGAAGAGTTGGCAGTCTTCTCGTTCTCTCCATTGTTCAG
TGCGTGCTCAACAAGTACTTGCCTTAGCTTTTGCATCAATGGATAGGTAG
CACTGCAGGGGTCATCAATGTATGCAAAGACGTGTTCGCGATCAGCCGCT
TTGAGCAGATCCTTCTCACAGAATCTTGATGGATGAAGCTCTCCACTAGC
ACCGACGGTTAAGACTTTCTTAGCTACTTGGCTGACAGTATTCTTGACTG
TATGCTTCAAATTTTCCTCCAAATGTCTCAAATCAATAGCCTGGCAAAGC
GCTACCAAGAATGTGGAAGACATGAGCTTCAGGATGTCGACTGCTTCAGC
AGTCTTCCTGGAAGAGATCAATCCCAAGGAGTTTACATCTTGGTTGTGCT
GTTCAGCACTTTGGACGTGGTTAGTAACAGGATTGGCAAGAAATTGGAGC
TCCGAAACATAGGAAGCCATAGCAATTTCAGCGCCCTTGAAACCCATATC
CAGGCTAGGATTCCTGCC
back to top