EY665459

Overview
NameEY665459
Unique NameEY665459
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length834
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH2_ORYSJ (Cell division protease ftsH homolog 2, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH2 PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.190e-79
Identity = 131/146 (89.73%), Postives = 131/146 (89.73%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAV           NDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLR   F
Sbjct:  230 VEFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRPGRF 375          

HSP 2 Score: 68.5514 bits (166), Expect = 1.190e-79
Identity = 39/70 (55.71%), Postives = 47/70 (67.14%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGR 644
            PGRFDRQV+VDVPD+RG+  +I +  GSNKKFD + VSL     +TPGF  AD A L  +A I A   GR
Sbjct:  372 PGRFDRQVSVDVPDVRGRT-EILKVHGSNKKFDTD-VSLEVIAMRTPGFSGADLANLLNEAAILAGRRGR 439          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH8_ARATH (Cell division protease ftsH homolog 8, chloroplastic OS=Arabidopsis thaliana GN=FTSH8 PE=1 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 2.885e-78
Identity = 129/146 (88.36%), Postives = 131/146 (89.73%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAV           NDEREQTLNQLLTEMDGFEGNTG+IV+AATNRADILDSALLR   F
Sbjct:  236 VEFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGVIVVAATNRADILDSALLRPGRF 381          

HSP 2 Score: 64.6994 bits (156), Expect = 2.885e-78
Identity = 36/70 (51.43%), Postives = 46/70 (65.71%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGR 644
            PGRFDRQV+VDVPD++G+  DI +    NKKF+ +GVSL     +TPGF  AD A L  +A I A   G+
Sbjct:  378 PGRFDRQVSVDVPDVKGRT-DILKVHSGNKKFE-SGVSLEVIAMRTPGFSGADLANLLNEAAILAGRRGK 445          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH2_ARATH (Cell division protease ftsH homolog 2, chloroplastic OS=Arabidopsis thaliana GN=FTSH2 PE=1 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 8.349e-78
Identity = 127/146 (86.99%), Postives = 131/146 (89.73%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLKKPERFTAVGA+IPKGVLL+GPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAV           NDEREQTLNQLLTEMDGFEGNTG+IV+AATNRADILDSALLR   F
Sbjct:  243 VEFLKKPERFTAVGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGVIVVAATNRADILDSALLRPGRF 388          

HSP 2 Score: 64.6994 bits (156), Expect = 8.349e-78
Identity = 36/65 (55.38%), Postives = 43/65 (66.15%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFA 629
            PGRFDRQV+VDVPD++G+  DI +    NKKFD N VSL     +TPGF  AD A L  +A I A
Sbjct:  385 PGRFDRQVSVDVPDVKGRT-DILKVHAGNKKFD-NDVSLEIIAMRTPGFSGADLANLLNEAAILA 447          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_GUITH (Cell division protease ftsH homolog OS=Guillardia theta GN=ftsH PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.851e-74
Identity = 124/146 (84.93%), Postives = 130/146 (89.04%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLKKPERFTAVGA+IPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKEN+PCIVF+DEIDAV           NDEREQTLNQLLTEMDGFEGNTGII+IAATNR D+LD+ALLR   F
Sbjct:  189 VSFLKKPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENSPCIVFIDEIDAVGRQRGTGIGGGNDEREQTLNQLLTEMDGFEGNTGIIIIAATNRVDVLDAALLRPGRF 334          

HSP 2 Score: 57.7658 bits (138), Expect = 1.851e-74
Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGI 623
            PGRFDRQVTVDVPD++G+  +I      NKK D + +SL    ++TPGF  AD A L  +A I
Sbjct:  331 PGRFDRQVTVDVPDVKGR-LEILNVHARNKKLDLS-ISLELIAKRTPGFSGADLANLLNEAAI 391          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_PORPU (Cell division protease ftsH homolog OS=Porphyra purpurea GN=ftsH PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 2.635e-73
Identity = 125/146 (85.62%), Postives = 130/146 (89.04%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLK+PE FTAVGA+IPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAK+NAPCIVF+DEIDAV           NDEREQTLNQLLTEMDGFEGNTG+IVIAATNRADILDSALLR   F
Sbjct:  189 VTFLKQPESFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIVFIDEIDAVGRQRGTGVGGGNDEREQTLNQLLTEMDGFEGNTGVIVIAATNRADILDSALLRPGRF 334          

HSP 2 Score: 54.6842 bits (130), Expect = 2.635e-73
Identity = 32/63 (50.79%), Postives = 38/63 (60.32%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGI 623
            PGRFDRQV+VDVPD RG+   I      NKK ++  VSL     +TPGF  AD A L  +A I
Sbjct:  331 PGRFDRQVSVDVPDFRGR-LAILEVHAKNKKMESK-VSLETIARRTPGFSGADLANLLNEAAI 391          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FSTH_PORYE (Cell division protease ftsH homolog OS=Porphyra yezoensis GN=ftsH PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 4.891e-72
Identity = 124/146 (84.93%), Postives = 129/146 (88.36%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLK+PE FTAVGA+IPKGVLLVGPPGTGKTLLAKAIAGEA VPFFSISGSEFVEMFVGVGASRVRDLFKKAK+NAPCIVF+DEIDAV           NDEREQTLNQLLTEMDGFEGNTG+IVIAATNRADILDSALLR   F
Sbjct:  189 VTFLKQPESFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIVFIDEIDAVGRQRGTGVGGGNDEREQTLNQLLTEMDGFEGNTGVIVIAATNRADILDSALLRPGRF 334          

HSP 2 Score: 52.7582 bits (125), Expect = 4.891e-72
Identity = 31/63 (49.21%), Postives = 37/63 (58.73%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGI 623
            PGRFDRQV+VDVPD +G+   I      NKK +   VSL     +TPGF  AD A L  +A I
Sbjct:  331 PGRFDRQVSVDVPDFKGR-LAILEVHAKNKKMEPK-VSLETIARRTPGFSGADLANLLNEAAI 391          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH2_SYNY3 (Cell division protease ftsH homolog 2 OS=Synechocystis sp. (strain PCC 6803) GN=slr1390 PE=3 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 5.336e-71
Identity = 119/146 (81.51%), Postives = 129/146 (88.36%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLK+PE+FTA+GA+IP+GVLL+GPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPC+VF+DEIDAV           NDEREQTLNQLLTEMDGFEGN+GIIVIAATNR D+LD ALLR   F
Sbjct:  227 VTFLKQPEKFTAIGAKIPRGVLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCLVFIDEIDAVGRQRGVGYGGGNDEREQTLNQLLTEMDGFEGNSGIIVIAATNRPDVLDLALLRPGRF 372          

HSP 2 Score: 53.1434 bits (126), Expect = 5.336e-71
Identity = 30/64 (46.88%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIF 626
            PGRFDRQVTVD PD++G+   I      NKK     V L     +TPGF  AD A +  +A IF
Sbjct:  369 PGRFDRQVTVDYPDVQGREL-ILAIHAQNKKLHEE-VQLAAIARRTPGFTGADLANVLNEAAIF 430          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH6_ARATH (Cell division protease ftsH homolog 6, chloroplastic OS=Arabidopsis thaliana GN=FTSH6 PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.408e-68
Identity = 113/146 (77.40%), Postives = 124/146 (84.93%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLK PE+F+A+GA+IPKGVLL GPPGTGKTLLAKAIAGEAGVPFFS+SGSEF+EMFVGVGASR RDLF KAK N+PCIVF+DEIDAV           NDEREQTLNQ+LTEMDGF GNTG+IVIAATNR +ILDSALLR   F
Sbjct:  240 VEFLKTPEKFSALGAKIPKGVLLTGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFIEMFVGVGASRARDLFNKAKANSPCIVFIDEIDAVGRMRGTGIGGGNDEREQTLNQILTEMDGFAGNTGVIVIAATNRPEILDSALLRPGRF 385          

HSP 2 Score: 55.8398 bits (133), Expect = 1.408e-68
Identity = 33/70 (47.14%), Postives = 43/70 (61.43%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGR 644
            PGRFDRQV+V +PDIRG+  +I +    +KK D + VSL     +TPGF  AD A L  +A I A   G+
Sbjct:  382 PGRFDRQVSVGLPDIRGR-EEILKVHSRSKKLDKD-VSLSVIAMRTPGFSGADLANLMNEAAILAGRRGK 449          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_CYAME (Cell division protease ftsH homolog OS=Cyanidioschyzon merolae GN=ftsH PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.614e-67
Identity = 118/146 (80.82%), Postives = 125/146 (85.62%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLK P +F AVGA IPKGVLLVGPPGTGKTLLAKAIAGEA VPFFSISGSEFVEMFVGVGASRVRDLFKKAK+NAPC+VF+DEIDAV           NDEREQTLNQLLTEMDGFEGNTG+IVIAATNR D+LD+ALLR   F
Sbjct:  170 VAFLKNPSKFLAVGASIPKGVLLVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKQNAPCLVFIDEIDAVGRQRGAGIGGGNDEREQTLNQLLTEMDGFEGNTGVIVIAATNRVDVLDAALLRPGRF 315          

HSP 2 Score: 45.4394 bits (106), Expect = 2.614e-67
Identity = 27/69 (39.13%), Postives = 37/69 (53.62%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDG 641
            PGRFDRQ+ V +PD++ +   +K    +N+K     VSL     +T GF  AD A L  +A I A   G
Sbjct:  312 PGRFDRQIMVSMPDVKSRIAILK--VHANQKKLHPQVSLEAVARRTAGFAGADLANLLNEAAILAVRRG 378          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH6_ORYSJ (Cell division protease ftsH homolog 6, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH6 PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 5.790e-67
Identity = 112/147 (76.19%), Postives = 125/147 (85.03%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGF-EGNTGIIVIAATNRADILDSALLRAWTF 445
            V+FLK PE+FTAVGAR PKGVLLVGPPGTGKTLLAKAIAGEAGVPFFS+SGSEF+EMFVGVGASRVRDLF +AK +APC+VF+DEIDAV           NDEREQTLNQLLTEMDGF  G+ G++VIAATNR +ILD+ALLR   F
Sbjct:  237 VQFLKFPEKFTAVGARTPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFIEMFVGVGASRVRDLFDRAKASAPCLVFIDEIDAVGRQRGAGIGGGNDEREQTLNQLLTEMDGFGGGDGGVVVIAATNRPEILDAALLRPGRF 383          

HSP 2 Score: 59.3066 bits (142), Expect = 5.790e-67
Identity = 35/77 (45.45%), Postives = 46/77 (59.74%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQVAIVFE 665
            PGRFDR+V+V +PD+RG+  +I    G+NK+ D  GVSL     +TPGF  AD A L  +A I A   G+    V E
Sbjct:  380 PGRFDRRVSVGLPDVRGR-EEILLVHGANKRLDP-GVSLAVVAMRTPGFSGADLANLMNEAAILAGRRGKDRITVSE 454          
The following BLAST results are available for this feature:
BLAST of EY665459 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 380
Match NameE-valueIdentityDescription
FTSH2_ORYSJ1.190e-7989.73Cell division protease ftsH homolog 2, chloroplast... [more]
FTSH8_ARATH2.885e-7888.36Cell division protease ftsH homolog 8, chloroplast... [more]
FTSH2_ARATH8.349e-7886.99Cell division protease ftsH homolog 2, chloroplast... [more]
FTSH_GUITH1.851e-7484.93Cell division protease ftsH homolog OS=Guillardia ... [more]
FTSH_PORPU2.635e-7385.62Cell division protease ftsH homolog OS=Porphyra pu... [more]
FSTH_PORYE4.891e-7284.93Cell division protease ftsH homolog OS=Porphyra ye... [more]
FTSH2_SYNY35.336e-7181.51Cell division protease ftsH homolog 2 OS=Synechocy... [more]
FTSH6_ARATH1.408e-6877.40Cell division protease ftsH homolog 6, chloroplast... [more]
FTSH_CYAME2.614e-6780.82Cell division protease ftsH homolog OS=Cyanidiosch... [more]
FTSH6_ORYSJ5.790e-6776.19Cell division protease ftsH homolog 6, chloroplast... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-102-002-D01-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 2 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665459 ID=EY665459|Name=EY665459|organism=Citrus sinensis|type=EST|length=834bp
CCCACGCGTCCGGTTCCTTAAGAAGCCTGAGAGATTTACAGCTGTTGGAG
CTCGTATTCCAAAGGGTGTTCTTCTCGTTGGTCCTCCAGGAACTGGGAAG
ACTCTTCTTGCCAAGGCAATTGCTGGTGAAGCCGGTGTTCCATTTTTCTC
CATATCAGGTTCTGAGTTTGTTGAGATGTTTGTTGGTGTCGGTGCATCTA
GAGTCCGAGATCTTTTCAAGAAGGCCAAAGAGAATGCTCCTTGCATTGTA
TTTGTGGATGAAATTGATGCCGTTGGAAGACAAAGAGGAACTGGAATTGG
AGGAGGGAATGATGAAAGAGAGCAGACCCTTAACCAGCTTTTGACAGAAA
TGGATGGTTTTGAGGGTAATACTGGTATCATTGTGATTGCTGCAACTAAC
AGGGCGGACATTCTTGATTCTGCCTTATTGAGGGCCTGGACGTTTTGATA
GACAGGTTACTGTTGATGTTCCTGACATTCGAGGAAAGAACAGAGATATT
AAAAGGTTCACGGGTAGCAACAAAAAATTTGATGCAAATGGTGTCTCCTT
GATGGGAAAGCCAGAACAAACCCCTGGGTTCCAGGCTGCTGACTTTGCAA
CCCTCAAAGAACAGGCAGGCATCTTTGCGTGCGACGACGGGCGGCAAGTG
GCTATTGTATTTGAAAAAAAATGACCAATACAAGTGAAACGCAATGTTCA
TTCACACCCAACACAATCACCCTCACCAAACACGGGCAGAAACGACTGAT
AGTCGGAACGCACAAACACGCGCCCGAGAAAAAGCAAGCACCCGAAACCT
CGGAAACAATAATGCCATCATTACAACTCAGACC
back to top