EY665457

Overview
NameEY665457
Unique NameEY665457
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length916
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX1_ARATH (Calnexin homolog 1 OS=Arabidopsis thaliana GN=CNX1 PE=1 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.479e-62
Identity = 124/215 (57.67%), Postives = 142/215 (66.05%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDFEPIAAVGIEIWDNAGWVFLFETFLISKDEKSCQVLSGLLHGSLKFGC*KRKLEGEEAAAWFKGLCRLPEKRN*FS*TRVAKIPFLDAYQ 775
            RAKIPDP+AVKPEDWDEDAPMEIEDE+A KPEGWL           ATKP            APKIDNPKCEAAPGCGEWKRPMKRNPAYKGKW +P IDNP YKGIWKP+ IPNP+YFELD+PD+EPIAA+GIEIW     + LF+  LI+KDEK  +          KF   K K + EE AA      +  +K       +VA + FL AY+
Sbjct:  237 RAKIPDPNAVKPEDWDEDAPMEIEDEEAEKPEGWLDDEPEEVDDPEATKPEDWDDEEDGMWEAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWSSPLIDNPAYKGIWKPRDIPNPDYFELDRPDYEPIAAIGIEIWTMQDGI-LFDNILIAKDEKVAETYRQTT-WKPKFDVEKEKQKAEEEAAGSADGLKSYQKVVFDLLNKVADLSFLSAYK 449          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX_SOYBN (Calnexin homolog OS=Glycine max PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 8.971e-60
Identity = 120/215 (55.81%), Postives = 140/215 (65.12%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDFEPIAAVGIEIWDNAGWVFLFETFLISKDEKSCQVLSGLLHGSLKFGC*KRKLEGEEAAAWFKGLCRLPEKRN*FS*TRVAKIPFLDAYQ 775
            RAKIPDP AVKP+DWDEDAPMEI DE+A KPEGWL           ATKP            APKI+NPKCEAAPGCGEWKRP KRNPAYKGKW AP+IDNP+YKGIWKP++IPNP YFEL KPDFEPIAA+GIEIW     + LF+  LI+ D+K  +          KF   K KL+ EE AA         +K+      ++A IPFL  ++
Sbjct:  246 RAKIPDPSAVKPDDWDEDAPMEILDEEAEKPEGWLDDEPEEIDDPEATKPEDWDDEEDGEWEAPKIENPKCEAAPGCGEWKRPTKRNPAYKGKWSAPYIDNPSYKGIWKPREIPNPEYFELAKPDFEPIAAIGIEIWTMQDGI-LFDNVLIANDDKVAESYRETT-WKPKFTVEKDKLKAEEEAATGSDGISGFQKKVFDLLYKIADIPFLSEHK 458          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX2_ARATH (Calnexin homolog 2 OS=Arabidopsis thaliana GN=At5g07340 PE=2 SV=2)

HSP 1 Score: 228.024 bits (580), Expect = 5.815e-59
Identity = 118/215 (54.88%), Postives = 140/215 (65.12%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDFEPIAAVGIEIWDNAGWVFLFETFLISKDEKSCQVLSGLLHGSLKFGC*KRKLEGEEAAAWFKGLCRLPEKRN*FS*TRVAKIPFLDAYQ 775
            RAKIPDP+AVKP+DWDEDAPMEIEDE+A KPEGWL           A+KP            APK+ N KCEAAPGCGEWKRPMKRNPAYKGKW +P IDNP YKGIWKP+ IPNP+YFEL++P+ EPIAA+GIEIW     + LF+  LISKDEK  +          KF   K K + E+ AA      +  +K+      +VA I FL AY+
Sbjct:  239 RAKIPDPNAVKPDDWDEDAPMEIEDEEAEKPEGWLDDEPVEVEDPEASKPEDWDDEEDGEWEAPKVSNTKCEAAPGCGEWKRPMKRNPAYKGKWSSPLIDNPAYKGIWKPRDIPNPDYFELERPNLEPIAAIGIEIWTMQDGI-LFDNILISKDEKVAETYRQST-WKPKFDVEKEKQKAEDEAAGEADGLKSYQKKVFDLLYKVADISFLSAYK 451          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX_HELTU (Calnexin homolog OS=Helianthus tuberosus PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 2.443e-57
Identity = 105/168 (62.50%), Postives = 124/168 (73.81%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDFEPIAAVGIEIWDNAGWVFLFETFLISKDEKSCQVLSGLLHGS 634
            RAKIPDP+A KP+DWDEDAPMEI DE+A KPEGWL           A KP            AP+I+NPKCE+APGCGEW+RP+KRNPAYKGKWHAP IDNP YKGIWKP++IPNP+YFEL+KP+FEPIAA+GIE  D    + LF+  LI+ DEK+    SG+L GS
Sbjct:  241 RAKIPDPEATKPDDWDEDAPMEILDEEAEKPEGWLDDEPEEIDDPEAVKPEDWDDEEDGEWEAPQIENPKCESAPGCGEWRRPLKRNPAYKGKWHAPLIDNPAYKGIWKPREIPNPDYFELEKPNFEPIAAIGIEDLDQQDGI-LFDNILIASDEKTA-AKSGILLGS 406          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX_PEA (Calnexin homolog OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 5.443e-57
Identity = 112/185 (60.54%), Postives = 125/185 (67.57%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDFEPIAAVGIEIWDNAGWVFLFETFLISKDEKSCQVLSGLLHGSLKFGC*KRKLEGEEAAA 685
            RAKIPDP+AVKPEDWDEDAP EI DE+A KPE WL             KP            APKI+NPKCEAAPGCGEWKRP K NPAYKGKW AP+IDNPNYKGIWKPQ+IPNP YFEL+KPDFEPIAA+GIEIW     + LF+  LI+KD+K  +          KF   K K + EE AA
Sbjct:  247 RAKIPDPEAVKPEDWDEDAPREIIDEEAEKPEPWLDHEPEVDDPE--AKPEDWDDEEDGEWEAPKIENPKCEAAPGCGEWKRPTKSNPAYKGKWSAPYIDNPNYKGIWKPQEIPNPEYFELEKPDFEPIAAIGIEIWTMQDGI-LFDNVLIAKDDKIAESYRETT-WKPKFNIEKEKQKHEEEAA 427          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX_MOUSE (Calnexin OS=Mus musculus GN=Canx PE=1 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.065e-44
Identity = 84/157 (53.50%), Postives = 104/157 (66.24%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFE-LDKPDFEPIAAVGIEIWDNAGWVFLFETFLISKDEK 598
            R KI DPDAVKP+DWDEDAP +I DE+A KPEGWL           A KP            AP+I NPKCE+APGCG W+RPM  NP YKGKW  P IDNPNY+GIWKP++IPNP++FE L+     P +A+G+E+W     +F F+ F+IS D +
Sbjct:  291 RPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIF-FDNFIISGDRR 446          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX_RAT (Calnexin OS=Rattus norvegicus GN=Canx PE=1 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.391e-44
Identity = 84/157 (53.50%), Postives = 104/157 (66.24%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFE-LDKPDFEPIAAVGIEIWDNAGWVFLFETFLISKDEK 598
            R KI DPDAVKP+DWDEDAP +I DE+A KPEGWL           A KP            AP+I NPKCE+APGCG W+RPM  NP YKGKW  P IDNPNY+GIWKP++IPNP++FE L+     P +A+G+E+W     +F F+ F+IS D +
Sbjct:  291 RPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIF-FDNFIISGDRR 446          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX_PONAB (Calnexin OS=Pongo abelii GN=CANX PE=2 SV=2)

HSP 1 Score: 178.333 bits (451), Expect = 5.284e-44
Identity = 82/157 (52.23%), Postives = 104/157 (66.24%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFE-LDKPDFEPIAAVGIEIWDNAGWVFLFETFLISKDEK 598
            R KIPDP+AVKP+DWDEDAP +I DE+A KPEGWL           A KP            AP+I NPKCE+APGCG W+RPM  NP YKGKW  P IDNP+Y+GIWKP++IPNP++FE L+     P +A+G+E+W     +F F+ F+I  D +
Sbjct:  290 RPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIF-FDNFIICADRR 445          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX_CANFA (Calnexin OS=Canis familiaris GN=CANX PE=1 SV=3)

HSP 1 Score: 178.333 bits (451), Expect = 5.284e-44
Identity = 81/157 (51.59%), Postives = 104/157 (66.24%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFE-LDKPDFEPIAAVGIEIWDNAGWVFLFETFLISKDEK 598
            R KIPDPDAVKP+DW+EDAP +I DE+A KP+GWL           A KP            AP+I NPKCE+APGCG W+RPM  NP YKGKW  P IDNPNY+GIWKP++IPNP++FE L+     P +A+G+E+W     +F F+ F++  D +
Sbjct:  291 RPKIPDPDAVKPDDWNEDAPAKIPDEEATKPDGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIF-FDNFIVCGDRR 446          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX_HUMAN (Calnexin OS=Homo sapiens GN=CANX PE=1 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 3.425e-43
Identity = 80/157 (50.96%), Postives = 104/157 (66.24%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFE-LDKPDFEPIAAVGIEIWDNAGWVFLFETFLISKDEK 598
            R KIPDP+AVKP+DWDEDAP +I DE+A KPEGWL           A KP            AP+I NP+CE+APGCG W+RP+  NP YKGKW  P IDNP+Y+GIWKP++IPNP++FE L+     P +A+G+E+W     +F F+ F+I  D +
Sbjct:  290 RPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIF-FDNFIICADRR 445          
The following BLAST results are available for this feature:
BLAST of EY665457 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
CALX1_ARATH1.479e-6257.67Calnexin homolog 1 OS=Arabidopsis thaliana GN=CNX1... [more]
CALX_SOYBN8.971e-6055.81Calnexin homolog OS=Glycine max PE=2 SV=1[more]
CALX2_ARATH5.815e-5954.88Calnexin homolog 2 OS=Arabidopsis thaliana GN=At5g... [more]
CALX_HELTU2.443e-5762.50Calnexin homolog OS=Helianthus tuberosus PE=2 SV=1[more]
CALX_PEA5.443e-5760.54Calnexin homolog OS=Pisum sativum PE=2 SV=1[more]
CALX_MOUSE1.065e-4453.50Calnexin OS=Mus musculus GN=Canx PE=1 SV=1[more]
CALX_RAT1.391e-4453.50Calnexin OS=Rattus norvegicus GN=Canx PE=1 SV=1[more]
CALX_PONAB5.284e-4452.23Calnexin OS=Pongo abelii GN=CANX PE=2 SV=2[more]
CALX_CANFA5.284e-4451.59Calnexin OS=Canis familiaris GN=CANX PE=1 SV=3[more]
CALX_HUMAN3.425e-4350.96Calnexin OS=Homo sapiens GN=CANX PE=1 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-102-002-C09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 2 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665457 ID=EY665457|Name=EY665457|organism=Citrus sinensis|type=EST|length=916bp
GTGACTGCGGTACGGTCGGGATTCCCGGGTCGACCCCGCGTCCGCGCTGC
TGATGATTTTCAGCCTCTTTCTCATTCCTGAGAAGACAATTCCTGATCCA
GATGACAAGAAGCCTGAGGATTGGGATGAGAGGGCAAAGATTCCTGACCC
TGATGCAGTAAAACCTGAAGACTGGGATGAGGATGCTCCCATGGAAATTG
AAGATGAGGATGCTGTGAAACCTGAAGGATGGCTGGATGATGACCCTGAG
GAGATAGATGACCCTGAGGCCACAAAACCTGAGGATTGGGATGATGAGGA
GGATGGTGAATGGGAGGCCCCAAAGATTGATAACCCAAAGTGTGAAGCAG
CCCCTGGATGCGGCGAGTGGAAGAGGCCAATGAAGAGGAATCCTGCCTAC
AAGGGCAAATGGCATGCTCCACATATTGACAACCCTAATTACAAGGGTAT
TTGGAAGCCTCAGCAGATTCCAAACCCCAACTATTTTGAGCTTGACAAAC
CTGACTTTGAGCCTATTGCTGCTGTTGGCATTGAGATCTGGGACAATGCA
GGATGGGTATTTTTGTTTGAAACATTTTTGATATCAAAGGATGAGAAAAG
TTGCCAAGTCCTATCGGGCCTCCTGCATGGAAGCCTAAAGTTTGGATGTT
GAAAAAGAAAACTTGAAGGTGAGGAAGCAGCTGCTTGGTTCAAAGGGCTT
TGCAGGCTTCCCGAAAAAAGGAATTGATTCTCTTGAACAAGGGTTGCAAA
AATTCCTTTCTTGGATGCATACCAACTTAAAAAATCTTGAATGGGATTGA
AAAAGGGAAAAAAAAAACCCAACCCTTAAAATTTGGGTTTTCCTTGCTTT
CTGTTTGGGGGGGGGAATTTTTCCCATTTCTTTTTCCAAAATACTTATTT
GTGGGGGGAAAAGAAA
back to top