EY665450

Overview
NameEY665450
Unique NameEY665450
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length835
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665450 vs. ExPASy Swiss-Prot
Match: PRS8B_ARATH (26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=2 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 4.649e-105
Identity = 195/206 (94.66%), Postives = 200/206 (97.09%), Query Frame = 1
Query:    1 AVAHHTPFTFIRVSGSELVPIYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETKKNMSLAKLWE 618
            AVAHHT  TFIRVSGSELV  YIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERR+HVTQEDFEMAVAKVMKK+T+KNMSL KLW+
Sbjct:  214 AVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEKNMSLRKLWK 419          
BLAST of EY665450 vs. ExPASy Swiss-Prot
Match: PRS8A_ARATH (26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=2 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 4.649e-105
Identity = 195/206 (94.66%), Postives = 200/206 (97.09%), Query Frame = 1
Query:    1 AVAHHTPFTFIRVSGSELVPIYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETKKNMSLAKLWE 618
            AVAHHT  TFIRVSGSELV  YIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERR+HVTQEDFEMAVAKVMKK+T+KNMSL KLW+
Sbjct:  214 AVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEKNMSLRKLWK 419          
BLAST of EY665450 vs. ExPASy Swiss-Prot
Match: PRS8_DICDI (26S protease regulatory subunit 8 OS=Dictyostelium discoideum GN=psmC5 PE=1 SV=2)

HSP 1 Score: 343.199 bits (879), Expect = 1.074e-93
Identity = 172/206 (83.50%), Postives = 191/206 (92.72%), Query Frame = 1
Query:    1 AVAHHTPFTFIRVSGSELVPIYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETKKNMSLAKLWE 618
            AVAHHT  TFIRVSGSELV  YIGEGSRMVRELF+MAREHAPSIIFMDEIDSIGS+R ESGSG GDSEVQRTMLELLNQLDGFE++  IKVLM TNRIDILD ALLRPGRIDRKIEFPNP +  RLDILKIHSR+MNL RGI+LKKI++KMNGASGAELKAVCTEAGM+ALRERR+HV+QEDFEMAV+KVMKK++++NMS+ KLW+
Sbjct:  198 AVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRGESGSGGGDSEVQRTMLELLNQLDGFESTKNIKVLMCTNRIDILDPALLRPGRIDRKIEFPNPGDAGRLDILKIHSRKMNLTRGINLKKISDKMNGASGAELKAVCTEAGMYALRERRVHVSQEDFEMAVSKVMKKDSEQNMSINKLWK 403          
BLAST of EY665450 vs. ExPASy Swiss-Prot
Match: PRS8_MANSE (26S protease regulatory subunit 8 OS=Manduca sexta PE=2 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 1.188e-92
Identity = 174/206 (84.47%), Postives = 192/206 (93.20%), Query Frame = 1
Query:    1 AVAHHTPFTFIRVSGSELVPIYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETKKNMSLAKLWE 618
            AVAHHT  TFIRVSGSELV  +IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELLNQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+RLDILKIHSR+MNL RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERR+HVTQEDFEMAVAKVM+K+++KNMS+ KLW+
Sbjct:  198 AVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 402          
BLAST of EY665450 vs. ExPASy Swiss-Prot
Match: PRS8_DROME (26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Pros45 PE=1 SV=2)

HSP 1 Score: 339.732 bits (870), Expect = 1.188e-92
Identity = 174/206 (84.47%), Postives = 192/206 (93.20%), Query Frame = 1
Query:    1 AVAHHTPFTFIRVSGSELVPIYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETKKNMSLAKLWE 618
            AVAHHT  TFIRVSGSELV  +IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELLNQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+RLDILKIHSR+MNL RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERR+HVTQEDFEMAVAKVM+K+++KNMS+ KLW+
Sbjct:  201 AVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 405          
BLAST of EY665450 vs. ExPASy Swiss-Prot
Match: PRS8_RAT (26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 4.513e-92
Identity = 172/206 (83.50%), Postives = 191/206 (92.72%), Query Frame = 1
Query:    1 AVAHHTPFTFIRVSGSELVPIYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETKKNMSLAKLWE 618
            AVAHHT  TFIRVSGSELV  +IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELLNQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+RLDILKIHSR+MNL RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERR+HVTQEDFEMAVAKVM+K+++KNMS+ KLW+
Sbjct:  202 AVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of EY665450 vs. ExPASy Swiss-Prot
Match: PRS8_PIG (26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 4.513e-92
Identity = 172/206 (83.50%), Postives = 191/206 (92.72%), Query Frame = 1
Query:    1 AVAHHTPFTFIRVSGSELVPIYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETKKNMSLAKLWE 618
            AVAHHT  TFIRVSGSELV  +IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELLNQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+RLDILKIHSR+MNL RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERR+HVTQEDFEMAVAKVM+K+++KNMS+ KLW+
Sbjct:  202 AVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of EY665450 vs. ExPASy Swiss-Prot
Match: PRS8_MOUSE (26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 4.513e-92
Identity = 172/206 (83.50%), Postives = 191/206 (92.72%), Query Frame = 1
Query:    1 AVAHHTPFTFIRVSGSELVPIYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETKKNMSLAKLWE 618
            AVAHHT  TFIRVSGSELV  +IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELLNQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+RLDILKIHSR+MNL RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERR+HVTQEDFEMAVAKVM+K+++KNMS+ KLW+
Sbjct:  202 AVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of EY665450 vs. ExPASy Swiss-Prot
Match: PRS8_HUMAN (26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 4.513e-92
Identity = 172/206 (83.50%), Postives = 191/206 (92.72%), Query Frame = 1
Query:    1 AVAHHTPFTFIRVSGSELVPIYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETKKNMSLAKLWE 618
            AVAHHT  TFIRVSGSELV  +IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELLNQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+RLDILKIHSR+MNL RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERR+HVTQEDFEMAVAKVM+K+++KNMS+ KLW+
Sbjct:  202 AVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
BLAST of EY665450 vs. ExPASy Swiss-Prot
Match: PRS8_BOVIN (26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 4.513e-92
Identity = 172/206 (83.50%), Postives = 191/206 (92.72%), Query Frame = 1
Query:    1 AVAHHTPFTFIRVSGSELVPIYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMNLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETKKNMSLAKLWE 618
            AVAHHT  TFIRVSGSELV  +IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELLNQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+RLDILKIHSR+MNL RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERR+HVTQEDFEMAVAKVM+K+++KNMS+ KLW+
Sbjct:  202 AVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 406          
The following BLAST results are available for this feature:
BLAST of EY665450 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 378
Match NameE-valueIdentityDescription
PRS8B_ARATH4.649e-10594.6626S protease regulatory subunit 8 homolog B OS=Ara... [more]
PRS8A_ARATH4.649e-10594.6626S protease regulatory subunit 8 homolog A OS=Ara... [more]
PRS8_DICDI1.074e-9383.5026S protease regulatory subunit 8 OS=Dictyostelium... [more]
PRS8_MANSE1.188e-9284.4726S protease regulatory subunit 8 OS=Manduca sexta... [more]
PRS8_DROME1.188e-9284.4726S protease regulatory subunit 8 OS=Drosophila me... [more]
PRS8_RAT4.513e-9283.5026S protease regulatory subunit 8 OS=Rattus norveg... [more]
PRS8_PIG4.513e-9283.5026S protease regulatory subunit 8 OS=Sus scrofa GN... [more]
PRS8_MOUSE4.513e-9283.5026S protease regulatory subunit 8 OS=Mus musculus ... [more]
PRS8_HUMAN4.513e-9283.5026S protease regulatory subunit 8 OS=Homo sapiens ... [more]
PRS8_BOVIN4.513e-9283.5026S protease regulatory subunit 8 OS=Bos taurus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-102-002-C02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 2 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665450 ID=EY665450|Name=EY665450|organism=Citrus sinensis|type=EST|length=835bp
GCTGTGGCTCATCATACCCCTTTTACTTTCATCAGGGTTTCTGGTTCTGA
ATTAGTCCCCATTTACATTGGAGAAGGCTCCAGAATGGTTAGAGAACTTT
TTGTTATGGCAAGGGAACATGCTCCGTCTATCATTTTTATGGATGAAATT
GACAGTATCGGATCTGCCCGAATGGAATCTGGCAGCGGAAATGGTGACAG
TGAGGTGCAGAGGACTATGCTGGAGCTGCTCAACCAGCTTGATGGATTTG
AAGCATCAAACAAAATTAAGGTTCTCATGGCGACAAATCGAATTGATATT
CTCGATCAAGCTCTTCTCAGGCCAGGACGAATTGACAGAAAGATTGAATT
TCCAAATCCTAATGAAGAGTCTCGTCTTGATATCCTAAAAATTCATTCAA
GAAGAATGAATTTAATGCGTGGCATTGATTTGAAGAAGATTGCCGAGAAG
ATGAATGGTGCATCTGGTGCGGAGCTTAAGGCTGTGTGCACAGAAGCCGG
TATGTTTGCTCTAAGAGAGAGAAGGATCCATGTAACACAGGAAGATTTTG
AGATGGCAGTGGCCAAGGTCATGAAAAAAGAAACAAAGAAAAACATGTCC
TTGGCGAAGTTGTGGGAGTAATCATTTCCATGTGCTGTGCTGGGTATTTG
CTTATTTTCTGAGCAAAATTCAAGTAGCCCTTAACGGGCCTTCCTTCTGG
TTCTGGGGACATTTGCCCAATAAGCCCCTTTTTCCCTGACTGGTTGTCTT
TTCTGGCCCTCCTACCCCCCTATGGAAAACAAAATTTGCCACCCTATTTT
TATCCAAAAAAAAAAAAAAAAAAAAAAAAAAGGGG
back to top