EY665448

Overview
NameEY665448
Unique NameEY665448
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length927
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY665448_ssr324 microsatellite EY665448_ssr324:324..333. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY665448 vs. ExPASy Swiss-Prot
Match: PSBP_CUCSA (Oxygen-evolving enhancer protein 2, chloroplastic OS=Cucumis sativus GN=PSBP PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.847e-29
Identity = 63/92 (68.48%), Postives = 76/92 (82.61%), Query Frame = 1
Query:  115 QEDDGSAVSRRLVLTVLIGAAADGSKVSPADAAYGESPNVFGKPKTNTDFLPYNGDGFKLAIPSQWNPIKEREIPRSRSSDTQDNLHCNAHM 390
            QE++G  VSRRL LTVLIGAAA GSKVSPADAAYGE+ NVFGKPK+NTD+LPY+GDGFKL+IPS+WNP KERE P  +    +DN   N+++
Sbjct:   46 QEEEGGVVSRRLALTVLIGAAALGSKVSPADAAYGEAANVFGKPKSNTDYLPYSGDGFKLSIPSKWNPSKEREFP-GQVLRYEDNFDSNSNL 136          
BLAST of EY665448 vs. ExPASy Swiss-Prot
Match: PSBP1_ARATH (Oxygen-evolving enhancer protein 2-1, chloroplastic OS=Arabidopsis thaliana GN=PSBP1 PE=1 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 1.846e-28
Identity = 59/74 (79.73%), Postives = 66/74 (89.19%), Query Frame = 1
Query:  118 EDDGSAVSRRLVLTVLIGAAADGSKVSPADAAYGESPNVFGKPKTNTDFLPYNGDGFKLAIPSQWNPIKEREIP 339
            EDD SAVSRRL LT+L+GAAA GSKVSPADAAYGE+ NVFGKPKTNTDFLPYNGDGFK+ +P++WNP KE E P
Sbjct:   47 EDDNSAVSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYP 120          
BLAST of EY665448 vs. ExPASy Swiss-Prot
Match: PSBP1_TOBAC (Oxygen-evolving enhancer protein 2-1, chloroplastic OS=Nicotiana tabacum GN=PSBP1 PE=3 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 7.754e-27
Identity = 60/77 (77.92%), Postives = 66/77 (85.71%), Query Frame = 1
Query:  115 QEDDGSAV--SRRLVLTVLIGAAADGSKVSPADAAYGESPNVFGKPKTNTDFLPYNGDGFKLAIPSQWNPIKEREIP 339
            QEDDG++V  SRRL LTVLIGAAA GSKVSPADAAYGE+ NVFGKPK NTDFL YNGDGFKL +P++WNP KE E P
Sbjct:   49 QEDDGNSVVVSRRLALTVLIGAAAIGSKVSPADAAYGEAANVFGKPKENTDFLAYNGDGFKLQVPAKWNPSKEVEFP 125          
BLAST of EY665448 vs. ExPASy Swiss-Prot
Match: PSBP_SPIOL (Oxygen-evolving enhancer protein 2, chloroplastic OS=Spinacia oleracea GN=PSBP PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.727e-26
Identity = 56/70 (80.00%), Postives = 62/70 (88.57%), Query Frame = 1
Query:  130 SAVSRRLVLTVLIGAAADGSKVSPADAAYGESPNVFGKPKTNTDFLPYNGDGFKLAIPSQWNPIKEREIP 339
            S VSRRL LTVLIGAAA GSKVSPADAAYGE+ NVFGKPK NT+F+PYNGDGFKL +PS+WNP KE+E P
Sbjct:   55 SGVSRRLALTVLIGAAAVGSKVSPADAAYGEAANVFGKPKKNTEFMPYNGDGFKLLVPSKWNPSKEKEFP 124          
BLAST of EY665448 vs. ExPASy Swiss-Prot
Match: PSBP_SOLLC (Oxygen-evolving enhancer protein 2, chloroplastic OS=Solanum lycopersicum GN=PSBP PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.947e-26
Identity = 58/78 (74.36%), Postives = 66/78 (84.62%), Query Frame = 1
Query:  112 EQEDDGS--AVSRRLVLTVLIGAAADGSKVSPADAAYGESPNVFGKPKTNTDFLPYNGDGFKLAIPSQWNPIKEREIP 339
            +++DD S  AVSRRL LT+LIG AA GSKVSPADAAYGE+ NVFGKPK NTDFLPYNGDGFKL +P++WNP KE E P
Sbjct:   38 QKQDDASNAAVSRRLALTLLIGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQVPAKWNPSKEVEYP 115          
BLAST of EY665448 vs. ExPASy Swiss-Prot
Match: PSBP_PEA (Oxygen-evolving enhancer protein 2, chloroplastic OS=Pisum sativum GN=PSBP PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 3.848e-26
Identity = 57/78 (73.08%), Postives = 67/78 (85.90%), Query Frame = 1
Query:  112 EQEDD--GSAVSRRLVLTVLIGAAADGSKVSPADAAYGESPNVFGKPKTNTDFLPYNGDGFKLAIPSQWNPIKEREIP 339
            +++DD   + VSRRL L+VLIGAAA GSKVSPADAAYGE+ NVFGK KTNTD+LPYNGDGFKL +P++WNP KERE P
Sbjct:   39 QKQDDVVDAVVSRRLALSVLIGAAAVGSKVSPADAAYGEAANVFGKAKTNTDYLPYNGDGFKLLVPAKWNPSKEREFP 116          
BLAST of EY665448 vs. ExPASy Swiss-Prot
Match: PSBP_SOLTU (Oxygen-evolving enhancer protein 2, chloroplastic OS=Solanum tuberosum GN=PSBP PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 6.564e-26
Identity = 58/80 (72.50%), Postives = 66/80 (82.50%), Query Frame = 1
Query:  112 EQEDDGS----AVSRRLVLTVLIGAAADGSKVSPADAAYGESPNVFGKPKTNTDFLPYNGDGFKLAIPSQWNPIKEREIP 339
            +++DD +    AVSRRL LT+LIG AA GSKVSPADAAYGE+ NVFGKPK NTDFLPYNGDGFKL IP++WNP KE E P
Sbjct:   38 QKQDDANNTSNAVSRRLALTLLIGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQIPAKWNPSKEIEFP 117          
BLAST of EY665448 vs. ExPASy Swiss-Prot
Match: PSBP2_TOBAC (Oxygen-evolving enhancer protein 2-2, chloroplastic OS=Nicotiana tabacum GN=PSBP2 PE=1 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 1.910e-25
Identity = 58/78 (74.36%), Postives = 63/78 (80.77%), Query Frame = 1
Query:  106 PYEQEDDGSAVSRRLVLTVLIGAAADGSKVSPADAAYGESPNVFGKPKTNTDFLPYNGDGFKLAIPSQWNPIKEREIP 339
            P E   +  +VSRRL LTVLIGAAA GSKVSPADAAYGE+ NVFGKPKT+TDF  YNGDGFKL IPS+WNP KE E P
Sbjct:   45 PQEDNVNSVSVSRRLALTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYP 122          
BLAST of EY665448 vs. ExPASy Swiss-Prot
Match: PSBP3_TOBAC (Oxygen-evolving enhancer protein 2-3, chloroplastic OS=Nicotiana tabacum GN=PSBP3 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 9.479e-25
Identity = 56/78 (71.79%), Postives = 63/78 (80.77%), Query Frame = 1
Query:  106 PYEQEDDGSAVSRRLVLTVLIGAAADGSKVSPADAAYGESPNVFGKPKTNTDFLPYNGDGFKLAIPSQWNPIKEREIP 339
            P +   +  +VSRRL LT+LIGAAA GSKVSPADAAYGE+ NVFGKPKT+TDF  YNGDGFKL IPS+WNP KE E P
Sbjct:   46 PQQDNVNSVSVSRRLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPSKWNPNKEVEYP 123          
BLAST of EY665448 vs. ExPASy Swiss-Prot
Match: PSBP_BRAJU (Oxygen-evolving enhancer protein 2, chloroplastic (Fragment) OS=Brassica juncea GN=PSBP PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.617e-24
Identity = 53/74 (71.62%), Postives = 62/74 (83.78%), Query Frame = 1
Query:  118 EDDGSAVSRRLVLTVLIGAAADGSKVSPADAAYGESPNVFGKPKTNTDFLPYNGDGFKLAIPSQWNPIKEREIP 339
            EDD S VSRRL LT+L+GAAA GSKVSPADAAYGE+ NVFGKPKTNTDF   NGDGF++ +P++WNP +E E P
Sbjct:    1 EDDTSTVSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFTAINGDGFQVQVPAKWNPSREVEYP 74          
The following BLAST results are available for this feature:
BLAST of EY665448 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
PSBP_CUCSA2.847e-2968.48Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP1_ARATH1.846e-2879.73Oxygen-evolving enhancer protein 2-1, chloroplasti... [more]
PSBP1_TOBAC7.754e-2777.92Oxygen-evolving enhancer protein 2-1, chloroplasti... [more]
PSBP_SPIOL1.727e-2680.00Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_SOLLC2.947e-2674.36Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_PEA3.848e-2673.08Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP_SOLTU6.564e-2672.50Oxygen-evolving enhancer protein 2, chloroplastic ... [more]
PSBP2_TOBAC1.910e-2574.36Oxygen-evolving enhancer protein 2-2, chloroplasti... [more]
PSBP3_TOBAC9.479e-2571.79Oxygen-evolving enhancer protein 2-3, chloroplasti... [more]
PSBP_BRAJU1.617e-2471.62Oxygen-evolving enhancer protein 2, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-102-002-B12-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 2 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665448 ID=EY665448|Name=EY665448|organism=Citrus sinensis|type=EST|length=927bp
GCTTCGCTCCTCTCTGCACTCTCTACTACTTCATAAAAAAGAGCATCATC
NNANNGNNAGGGGNCGAANAANAAGAAAAAGAAGAAAGGGGGGGGGGGGN
AGATCCCCTATGAACAAGAAGATGACGGCAGCGCCGTCTCCCGCCGCTTG
GTTCTGACGGTGCTCATTGGTGCTGCTGCCGACGGCTCCAAGGTCTCTCC
TGCCGACGCTGCCTACGGCGAATCACCCAATGTGTTTGGTAAGCCAAAGA
CCAACACTGACTTCTTGCCATACAATGGAGATGGATTCAAACTAGCGATT
CCCTCACAATGGAACCCCATCAAAGAGAGAGAGATCCCCCGGTCGAGGTC
TTCAGATACCCAAGACAACTTGCATTGCAACGCGCACATGTTCCCGCCCT
AATCACCCCCCTACTGACAACAAAACTCACTCGCTGACCAAACGCACCCC
CCGACGAAATCCCTCAGTAATAGGGGAACGACTAGCCTGGGAAAAACAAC
GCCCATTCCTCGCAAAAATCTTACTCCCTCAGGGAGGGACTACCAAACCC
GACGGCCTGGGCCACCCCCCCTACCCATCCTTGAAGGAGCTTCAAGGACC
AACCCCACACCAACTAACTTTCTTTGTCCGGCAATCATCCAACCACATTG
CGCCGATCGCGAAACCCAAGAGGGGGCAACACATAACACCCTAAACATTC
GCACGCCCGCCTATACAACCGCAGCCCGCACCCCTCTTCTCACCTCTCAT
CGCCCACCAACCCCACGACGAACAAACATAGGGTGACCCTTCACGGCAAA
CAACACACATATCCAGACTCCCACACCCCCCCCCGCCCACCAATATCTCT
CTCCCAGTCGCCGCCTCCCCACCTACACCTCTCAACACACAAAACCTATG
CCTCTACCTAAAAAAGCAACGTGGAAC
back to top