EY665439

Overview
NameEY665439
Unique NameEY665439
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length912
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665439 vs. ExPASy Swiss-Prot
Match: C82A3_SOYBN (Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.875e-34
Identity = 65/143 (45.45%), Postives = 97/143 (67.83%), Query Frame = 2
Query:  167 APEPFGAWPLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFTTNDRVLATRPSIAAGKYLGYDNAVFALAPYGQYWRDIRKIATTDLLSGHRLELLKHVRYSEXDTFIKDLYSLCSKNAFNPAK 595
            AP   GAWP++GHL LL   +   K+LGA+ADKYGP+++++LG  P L++S+WE+ K+ FTTND  +++RP + A + + Y+ A   LAPYG YWR++RKI T + LS  R+E   H+R SE  T IK+L+ + S    N ++
Sbjct:   38 APVVSGAWPILGHLSLLNGSQTPHKVLGALADKYGPLFTIKLGMKPALVLSNWEMSKELFTTNDLAVSSRPKLVAVEVMSYNQAFVGLAPYGPYWRELRKIVTFEFLSNRRIEQRNHIRVSEVRTSIKELFDIWSNGNKNESR 180          
BLAST of EY665439 vs. ExPASy Swiss-Prot
Match: C82A1_PEA (Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2)

HSP 1 Score: 141.739 bits (356), Expect = 5.423e-33
Identity = 63/130 (48.46%), Postives = 91/130 (70.00%), Query Frame = 2
Query:  182 GAWPLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFTTNDRVLATRPSIAAGKYLGYDNAVFALAPYGQYWRDIRKIATTDLLSGHRLELLKHVRYSEXDTFIKDLYSLCS 571
            G+WPL+GHLPL+   +   K LGA+ DKYGPI++++LG    L++S+WE+ K+CFT ND V+++RP   A + + Y+ A    APYG YWR +RKI T ++LS  R+ELL H+R SE  T IK+L ++ S
Sbjct:   40 GSWPLLGHLPLMRNTQTPHKTLGALVDKYGPIFTIKLGATNALVLSNWELAKECFTKNDIVVSSRPKPVAVELMSYNQAFIGWAPYGAYWRQLRKIVTLEILSNRRIELLSHIRVSEVQTSIKELVNVWS 169          
BLAST of EY665439 vs. ExPASy Swiss-Prot
Match: C82A4_SOYBN (Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 7.082e-33
Identity = 62/133 (46.62%), Postives = 92/133 (69.17%), Query Frame = 2
Query:  167 APEPFGAWPLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFTTNDRVLATRPSIAAGKYLGYDNAVFALAPYGQYWRDIRKIATTDLLSGHRLELLKHVRYSEXDTFIKDLYSL 565
            AP   GAWP+ GHLPLLI  +   K LGA+A+K+GP+++++LG    L+VS WE+ ++CFTTND  ++ RP +   + + Y+NA+  +APYG YWR++RKI  T++LS  R+E L+ VR SE    I +LY +
Sbjct:   40 APTVGGAWPIFGHLPLLIGSKSPHKALGALAEKHGPLFTIKLGAKKALVVSDWEMARECFTTNDVAVSARPKLLVAELMCYNNAMLLVAPYGPYWRELRKIIVTEILSSSRVEQLQDVRVSEVQNSIVELYDV 172          
BLAST of EY665439 vs. ExPASy Swiss-Prot
Match: C82A2_SOYBN (Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 6.629e-31
Identity = 59/130 (45.38%), Postives = 89/130 (68.46%), Query Frame = 2
Query:  170 PEPFGAWPLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFTTNDRVLATRPSIAAGKYLGYDNAVFALAPYGQYWRDIRKIATTDLLSGHRLELLKHVRYSEXDTFIKDLY 559
            P   GAWP+IGHLPLL+  +   K LG +ADKYGPI+S+++G    ++VS+WE+ K+C+TTND  +++ P + +   L Y+ ++  +APYG YWR +RKI  ++ LS  R+E L HVR SE  + I +L+
Sbjct:   38 PTVAGAWPIIGHLPLLLGSKTPHKTLGDLADKYGPIFSIKIGAKNAVVVSNWEMAKECYTTNDIAVSSLPDLISANLLCYNRSMIVVAPYGPYWRQLRKILMSEFLSPSRVEQLHHVRVSEVQSSITELF 167          
BLAST of EY665439 vs. ExPASy Swiss-Prot
Match: C75A1_PINTA (Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.385e-20
Identity = 56/146 (38.36%), Postives = 82/146 (56.16%), Query Frame = 2
Query:  170 PEPFGAWPLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFTTNDRVLATRPSIAAGKYLGYDNAVFALAPYGQYWRDIRKIATTDLLSGHRLELLKHVRYSEXDTFIKDLY--SLCSKNAFNPAKGV 601
            P P+  WP+IG+   +    P+ + L  +A+KYGPI  LR G  PT++VSS E  K    T+D + A+RP  + GKY  Y+    A +PYG +WR +RKI   +LL+  R+E  KHVR  E    I  ++  S   + A N +K +
Sbjct:   44 PGPY-PWPIIGNFHQV--RLPLHRTLKNLAEKYGPILFLRFGSVPTVVVSSSEKAKHFLKTHDLIFASRPPTSVGKYFFYNFKDIAFSPYGDHWRKMRKICVLELLTSKRIESFKHVRQEELSAMIHSIWEESESGRIAVNVSKAI 186          
BLAST of EY665439 vs. ExPASy Swiss-Prot
Match: C81D1_ARATH (Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 7.602e-19
Identity = 53/138 (38.41%), Postives = 78/138 (56.52%), Query Frame = 2
Query:  170 PEPFGAWPLIGHLPLLIAEEPVCKILGAIADKY-----GPIYSLRLGKHPTLIVSSWEIV-KDCFTTNDRVLATRPSIAAGKYLGYDNAVFALAPYGQYWRDIRKIATTDLLSGHRLELLKHVRYSEXDTFIKDLYSL 565
            P P G  P+IGHL LL  + P+ + L + ++       G + SLRLG     +VSS ++  ++CF  ND VLA RP +  GK++GY+N     APYG +WR++R++ T ++ S HRL    +VR  E    I  L  L
Sbjct:   35 PSPPGWLPIIGHLRLL--KPPIHRTLRSFSETLDHNDGGGVMSLRLGSRLVYVVSSHKVAAEECFGKNDVVLANRPQVIIGKHVGYNNTNMIAAPYGDHWRNLRRLCTIEIFSTHRLNCFLYVRTDEVRRLISRLSRL 170          
BLAST of EY665439 vs. ExPASy Swiss-Prot
Match: C81F1_ARATH (Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 1.694e-18
Identity = 43/115 (37.39%), Postives = 74/115 (64.35%), Query Frame = 2
Query:  191 PLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFT-TNDRVLATRPSIAAGKYLGYDNAVFALAPYGQYWRDIRKIATTDLLSGHRLELLKHVRYSE 532
            P +GHL L+  + P+ ++L   +++YGPI+SLR G    ++++S  + ++ FT  ND VL++RP     KY+ Y++     APYG +WR++R+I + ++LS HRL   +H+R  E
Sbjct:   36 PFVGHLHLM--KPPIHRLLQRYSNQYGPIFSLRFGSRRVVVITSPSLAQESFTGQNDIVLSSRPLQLTAKYVAYNHTTVGTAPYGDHWRNLRRICSQEILSSHRLINFQHIRKDE 148          
BLAST of EY665439 vs. ExPASy Swiss-Prot
Match: C71D8_SOYBN (Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.872e-17
Identity = 50/132 (37.88%), Postives = 74/132 (56.06%), Query Frame = 2
Query:  176 PFGAW--PLIGHL-PLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFTTNDRVLATRPSIAAGKYLGYDNAVFALAPYGQYWRDIRKIATTDLLSGHRLELLKHVRYSEXDTFIKDLYS 562
            P G W  P+IG+L  L +A     + L  +  KYGP+  L+LG+  TL+VSS ++  +   T+D     RP + A +++ Y     A APYG YWR IRKI T +LLS  R++   H+R  E    I+ ++S
Sbjct:   34 PPGPWRLPIIGNLHQLALAASLPDQALQKLVRKYGPLMHLQLGEISTLVVSSPKMAMEMMKTHDVHFVQRPQLLAPQFMVYGATDIAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQSIHS 165          
BLAST of EY665439 vs. ExPASy Swiss-Prot
Match: C71D9_SOYBN (Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.445e-17
Identity = 52/148 (35.14%), Postives = 81/148 (54.73%), Query Frame = 2
Query:  176 PFGAW--PLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFTTNDRVLATRPSIAAGKYLGYDNAVFALAPYGQYWRDIRKIATTDLLSGHRLELLKHVRYSEXDTFIKDLYSLCSKNAFNPAKGVISKV 613
            P G W  P+IG++  L+        L  ++ KYG +  L+LG+  T++VSS E  K+   T+D + A+RP + A + + YD    A  PYG YWR +RKI   +LLS  R++  + +R     +FIK + ++   +  N  K VIS V
Sbjct:   36 PPGPWKLPIIGNMHNLVGSPLPHHRLRDLSAKYGSLMHLKLGEVSTIVVSSPEYAKEVMKTHDHIFASRPYVLAAEIMDYDFKGVAFTPYGDYWRQLRKIFALELLSSKRVQSFQPIREEVLTSFIKRMATI-EGSQVNVTKEVISTV 182          
BLAST of EY665439 vs. ExPASy Swiss-Prot
Match: C81E1_GLYEC (Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 4.171e-17
Identity = 46/129 (35.66%), Postives = 70/129 (54.26%), Query Frame = 2
Query:  191 PLIGHLPLLIAEEPVCKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFTTNDRVLATRPSIAAGKYLGYDNAVFALAPYGQYWRDIRKIATTDLLSGHRLELLKHVRYSEXDTFIKDLYSLCSKN 577
            P+IG+L  L  + P+ +    +++KYG ++SL  G    ++VSS    + CFT ND VLA RP   +GKY+ Y+        YG++WR++R+I   D+LS HR+     +R  E    I  L    S N
Sbjct:   40 PIIGNLHHL--KRPLHRTFKGLSEKYGHVFSLWFGSRLVVVVSSASEFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGSTSYGEHWRNLRRITALDVLSNHRINSFSGIRRDETQRLITRLADDSSTN 166          
The following BLAST results are available for this feature:
BLAST of EY665439 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 70
Match NameE-valueIdentityDescription
C82A3_SOYBN2.875e-3445.45Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=... [more]
C82A1_PEA5.423e-3348.46Cytochrome P450 82A1 (Fragment) OS=Pisum sativum G... [more]
C82A4_SOYBN7.082e-3346.62Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=... [more]
C82A2_SOYBN6.629e-3145.38Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=... [more]
C75A1_PINTA1.385e-2038.36Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 P... [more]
C81D1_ARATH7.602e-1938.41Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CY... [more]
C81F1_ARATH1.694e-1837.39Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CY... [more]
C71D8_SOYBN1.872e-1737.88Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=... [more]
C71D9_SOYBN2.445e-1735.14Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=... [more]
C81E1_GLYEC4.171e-1735.66Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-102-002-A10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 2 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665439 ID=EY665439|Name=EY665439|organism=Citrus sinensis|type=EST|length=912bp
GCCGTGCCGCGGTACGGTCGGATTCCGGGTCGACCCACGCGTCCGCCAAA
CCACCATGGATTTTATTTCTTTCAAGCTAGCAATTTTGGAGCTCTTAGCT
TTGCTGATTCTTTATATCTTATGGGGAATCGTAGCAAAATCCAAAAACAA
AAGCAAGAAAAATACAGCCCCCGAACCATTTGGGGCATGGCCACTCATCG
GCCATTTGCCTCTTCTGATTGCCGAAGAACCTGTTTGCAAAATACTCGGA
GCCATTGCTGACAAATATGGCCCCATCTACTCCCTCAGGCTCGGCAAGCA
TCCAACGTTGATTGTGAGCAGTTGGGAAATTGTGAAGGATTGCTTCACTA
CCAATGACAGAGTTTTGGCCACAAGGCCAAGTATAGCAGCAGGCAAGTAC
TTGGGTTACGACAACGCCGTTTTTGCGCTTGCTCCCTACGGCCAGTACTG
GCGTGATATTCGCAAAATAGCCACCACAGATCTGCTCTCCGGTCACCGGC
TTGAATTGCTAAAGCACGTTCGCTACTCAGAAGNTGACACTTTCATCAAA
GACTTGTACTCACTTTGCTCAAAAAACGCATTCAATCCTGCGAAGGGGGT
GATCAGCAAGGTAAATAAAACAACTGGATTTCCAATATAAGCCTTCAACT
GAAAAGCCGGAAAAAAAATTTTCACCTTAAAAAATTTTGGGGAAACAAGG
GAGCGAAGGGAATGGGGGAATCAAAAAAAGGCCCTAAAAAAAACTTACGA
ATTTTGAACAGGGGTTTTTTGTTTTTGGGGAAAAGCCATAACCGGGGCTT
TGAAGGGGATTGATTTTTCAGGGGCCCCATAGGGGTTCTTAGGGGAGGGA
ATGCAAAAAAAAATTTAACAAACCGGATTCGGGAACTGGGGTTTTAAAAA
AAAATGCCCCCA
back to top