EY665416

Overview
NameEY665416
Unique NameEY665416
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1026
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665416 vs. ExPASy Swiss-Prot
Match: FER2_ARATH (Ferredoxin-2, chloroplastic OS=Arabidopsis thaliana GN=FD2 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.507e-41
Identity = 57/84 (67.86%), Postives = 65/84 (77.38%), Query Frame = 2
Query:  209 GEEEINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVXXXXXXXXXXXXIGERFCLTCAAYPTSDVTIETHKEEEL 460
            GE E+ C DD ++LDAAEEAG+DLPYSCRAG+CSSC GKVVSG+V            IGE F LTCAAYPTSDVTIETHKEE++
Sbjct:   64 GELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEDI 147          

HSP 2 Score: 68.5514 bits (166), Expect = 4.507e-41
Identity = 37/59 (62.71%), Postives = 45/59 (76.27%), Query Frame = 1
Query:   43 LSSAMVSTSFIRSKPTATSLKAMPNMG-QAIFGLKAN--RGGRVVAMATYKVKLITPEG 210
            LSSA+V TSFIR  P   SL+++P+   Q++FGLK+   RGGRV AMATYKVK ITPEG
Sbjct:    6 LSSAIVGTSFIRRSPAPISLRSLPSANTQSLFGLKSGTARGGRVTAMATYKVKFITPEG 64          
BLAST of EY665416 vs. ExPASy Swiss-Prot
Match: FER_CAPAN (Ferredoxin, chloroplastic OS=Capsicum annuum GN=AP1 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.834e-39
Identity = 50/86 (58.14%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  209 GEEEINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVXXXXXXXXXXXXIGERFCLTCAAYPTSDVTIETHKEEELAG 466
            G  E +CPD+ +ILD AEEAG DLPYSCRAG+CSSC GK+  G V            + E + LTC AYP SDVTIETHKE EL G
Sbjct:   59 GPIEFDCPDNVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTDGNFLDDDQLEEGWVLTCVAYPQSDVTIETHKEAELVG 144          

HSP 2 Score: 80.1073 bits (196), Expect = 1.834e-39
Identity = 36/59 (61.02%), Postives = 49/59 (83.05%), Query Frame = 1
Query:   34 MATLSSAMVSTSFIRSKPTATSLKAMPNMGQAIFGLKANRGGRVVAMATYKVKLITPEG 210
            MA++S+ M+STSF+  KP  TSLK +PN+G+A+FGLK+  GG+V  MA+YKVKLITP+G
Sbjct:    1 MASVSATMISTSFMPRKPAVTSLKPIPNVGEALFGLKSANGGKVTCMASYKVKLITPDG 59          
BLAST of EY665416 vs. ExPASy Swiss-Prot
Match: FER1_SOLLC (Ferredoxin-1, chloroplastic OS=Solanum lycopersicum GN=SEND33 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.114e-39
Identity = 50/84 (59.52%), Postives = 54/84 (64.29%), Query Frame = 2
Query:  209 GEEEINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVXXXXXXXXXXXXIGERFCLTCAAYPTSDVTIETHKEEEL 460
            G  E  CPDD +ILD AEE G DLPYSCRAG+CSSC GKV +G+V                F LTC AYP  DVTIETHKEEEL
Sbjct:   59 GPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGSVDQSDGNFLDEDQEAAGFVLTCVAYPKGDVTIETHKEEEL 142          

HSP 2 Score: 81.6481 bits (200), Expect = 3.114e-39
Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 1
Query:   34 MATLSSAMVSTSFIRSKPTATSLKAMPNMGQAIFGLKANRGGRVVAMATYKVKLITPEG 210
            MA++S  M+STSF+  KP  TSLKA+ N+G+A+FGLK+ R GR+  MA+YKVKLITPEG
Sbjct:    1 MASISGTMISTSFLPRKPAVTSLKAISNVGEALFGLKSGRNGRITCMASYKVKLITPEG 59          
BLAST of EY665416 vs. ExPASy Swiss-Prot
Match: FER1_ARATH (Ferredoxin-1, chloroplastic OS=Arabidopsis thaliana GN=FD1 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 3.365e-38
Identity = 51/84 (60.71%), Postives = 62/84 (73.81%), Query Frame = 2
Query:  209 GEEEINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVXXXXXXXXXXXXIGERFCLTCAAYPTSDVTIETHKEEEL 460
            GE+E+ C +D ++LDAAEEAGLDLPYSCRAG+CSSC GKVVSG++            + E + LTC AYPTSDV IETHKEE +
Sbjct:   64 GEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMSEGYVLTCVAYPTSDVVIETHKEEAI 147          

HSP 2 Score: 67.3958 bits (163), Expect = 3.365e-38
Identity = 37/59 (62.71%), Postives = 47/59 (79.66%), Query Frame = 1
Query:   43 LSSAMVSTSFIRSKPTATSLKAMPNMG-QAIFGLKAN--RGGRVVAMATYKVKLITPEG 210
            LSSA+VSTSF+R + T  SL+++P    Q++FGLK++  RGGRV AMATYKVK ITPEG
Sbjct:    6 LSSAIVSTSFLRRQQTPISLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFITPEG 64          
BLAST of EY665416 vs. ExPASy Swiss-Prot
Match: FER1_MESCR (Ferredoxin-1, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.793e-37
Identity = 55/84 (65.48%), Postives = 63/84 (75.00%), Query Frame = 2
Query:  209 GEEEINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVXXXXXXXXXXXXIGERFCLTCAAYPTSDVTIETHKEEEL 460
            G++E+ CPDD +ILDAAEEAG+DLPYSCRAG+CSSC GKV SG+V            I E + LTC AYPT DVTIETHKEEEL
Sbjct:   63 GKQELECPDDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVTSGSVNQDDGSFLDDDQIKEGWVLTCVAYPTGDVTIETHKEEEL 146          

HSP 2 Score: 60.077 bits (144), Expect = 2.793e-37
Identity = 35/65 (53.85%), Postives = 46/65 (70.77%), Query Frame = 1
Query:   25 AATMATLSSAMVSTSFIRSKPTATSLKAMP-NMGQAIFGLKANRG-GRVVAMATYKVKLITPEGR 213
            AAT A LS A +ST+F    P  T+  A+P N+G+A+FGLK++   GRV AMA YKV L+TPEG+
Sbjct:    2 AATTAALSGATMSTAFAPKTPPMTA--ALPTNVGRALFGLKSSASRGRVTAMAAYKVTLVTPEGK 64          
BLAST of EY665416 vs. ExPASy Swiss-Prot
Match: FER_SILPR (Ferredoxin, chloroplastic OS=Silene pratensis GN=PETF PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 8.401e-33
Identity = 50/84 (59.52%), Postives = 60/84 (71.43%), Query Frame = 2
Query:  209 GEEEINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVXXXXXXXXXXXXIGERFCLTCAAYPTSDVTIETHKEEEL 460
            G    +CPDD ++LD AEE G+DLPYSCRAG+CSSC GKVV+G+V            I   + LTCAAYP++DVTIETHKEEEL
Sbjct:   61 GTVTFDCPDDVYVLDQAEEEGIDLPYSCRAGSCSSCAGKVVAGSVDQSDQSFLDDDQIEAGWVLTCAAYPSADVTIETHKEEEL 144          

HSP 2 Score: 55.8398 bits (133), Expect = 8.401e-33
Identity = 30/57 (52.63%), Postives = 36/57 (63.16%), Query Frame = 1
Query:   37 ATLSSAMVSTSFIRSKPTATSLKAMPNMGQAIFGLKANRGGRVVAMATYKVKLITPE 207
            +TLS+  VS S +  +    +     NMGQA+FGLKA   GRV AMATYKV LIT E
Sbjct:    3 STLSTLSVSASLLPKQQPMVASSLPTNMGQALFGLKAGSRGRVTAMATYKVTLITKE 59          
BLAST of EY665416 vs. ExPASy Swiss-Prot
Match: FER1_PEA (Ferredoxin-1, chloroplastic OS=Pisum sativum GN=PETF PE=1 SV=2)

HSP 1 Score: 107.071 bits (266), Expect = 1.534e-31
Identity = 51/84 (60.71%), Postives = 56/84 (66.67%), Query Frame = 2
Query:  209 GEEEINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVXXXXXXXXXXXXIGERFCLTCAAYPTSDVTIETHKEEEL 460
            G +E  CP D +ILD AEE G+DLPYSCRAG+CSSC GKVV G V            I   F LTC AYPTSDV IETHKEE+L
Sbjct:   64 GTQEFECPSDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVVGGEVDQSDGSFLDDEQIEAGFVLTCVAYPTSDVVIETHKEEDL 147          

HSP 2 Score: 51.2174 bits (121), Expect = 1.534e-31
Identity = 28/63 (44.44%), Postives = 36/63 (57.14%), Query Frame = 1
Query:   28 ATMATLSSAMVSTSFIRSKPTATSLKAMPNMGQAIFGLKAN--RGGRVVAMATYKVKLITPEG 210
            AT   L    VSTSF+R++P   S+           GLK +  RG   VAMA+YKVKL+TP+G
Sbjct:    2 ATTPALYGTAVSTSFLRTQPMPMSVTTTKAFSNGFLGLKTSLKRGDLAVAMASYKVKLVTPDG 64          
BLAST of EY665416 vs. ExPASy Swiss-Prot
Match: FER1_SPIOL (Ferredoxin-1, chloroplastic OS=Spinacia oleracea GN=PETF PE=1 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 3.650e-30
Identity = 52/84 (61.90%), Postives = 60/84 (71.43%), Query Frame = 2
Query:  209 GEEEINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVXXXXXXXXXXXXIGERFCLTCAAYPTSDVTIETHKEEEL 460
            G  E  CPDD +ILDAAEE G+DLPYSCRAG+CSSC GK+ +G++            I E + LTCAAYP SDVTIETHKEEEL
Sbjct:   62 GNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEEL 145          

HSP 2 Score: 43.5134 bits (101), Expect = 3.650e-30
Identity = 27/64 (42.19%), Postives = 40/64 (62.50%), Query Frame = 1
Query:   25 AATMATLSSAMVSTSFIRSKPTATSLKAMP-NMGQAIFGLKA-NRGGRVVAMATYKVKLITPEG 210
            AAT  T+    ++T+F+        + A+P N G+++FGLK  +RGGR+  MA YKV L+TP G
Sbjct:    2 AATTTTMMG--MATTFVPKPQAPPMMAALPSNTGRSLFGLKTGSRGGRMT-MAAYKVTLVTPTG 62          
BLAST of EY665416 vs. ExPASy Swiss-Prot
Match: FER1_MAIZE (Ferredoxin-1, chloroplastic OS=Zea mays GN=FDX1 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.365e-29
Identity = 54/86 (62.79%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  209 GEEEINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVXXXXXXXXXXXXIGERFCLTCAAYPTSDVTIETHKEEELAG 466
            GE E+  PDD +ILD AEE G+DLPYSCRAG+CSSC GKVVSG+V            I + + LTC AYPTSDV IETHKEEEL G
Sbjct:   64 GEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELTG 149          

HSP 2 Score: 40.0466 bits (92), Expect = 1.365e-29
Identity = 23/50 (46.00%), Postives = 31/50 (62.00%), Query Frame = 1
Query:   61 STSFIRSKPTATSLKAMPNMGQAIFGLKANRGGRVVAMATYKVKLITPEG 210
            S+S +R+ P  T++ A+P     I G  A+   R+ A ATY VKLITPEG
Sbjct:   16 SSSSLRAAPAPTAV-ALPAAKVGIMGRSASSRRRLRAQATYNVKLITPEG 64          
BLAST of EY665416 vs. ExPASy Swiss-Prot
Match: FER_BRANA (Ferredoxin OS=Brassica napus PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.159e-28
Identity = 58/84 (69.05%), Postives = 64/84 (76.19%), Query Frame = 2
Query:  209 GEEEINCPDDSFILDAAEEAGLDLPYSCRAGACSSCTGKVVSGTVXXXXXXXXXXXXIGERFCLTCAAYPTSDVTIETHKEEEL 460
            GE+E+ C DD ++LDAAEEAG+DLPYSCRAG+CSSC GKVVSG V            I E F LTCAAYPTSDVTIETHKEEEL
Sbjct:   12 GEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGFVDQSDESFLDDDQIAEGFVLTCAAYPTSDVTIETHKEEEL 95          

HSP 2 Score: 26.5646 bits (57), Expect = 1.159e-28
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  175 ATYKVKLITPEG 210
            ATYKVK ITPEG
Sbjct:    1 ATYKVKFITPEG 12          
The following BLAST results are available for this feature:
BLAST of EY665416 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 109
Match NameE-valueIdentityDescription
FER2_ARATH4.507e-4167.86Ferredoxin-2, chloroplastic OS=Arabidopsis thalian... [more]
FER_CAPAN1.834e-3958.14Ferredoxin, chloroplastic OS=Capsicum annuum GN=AP... [more]
FER1_SOLLC3.114e-3959.52Ferredoxin-1, chloroplastic OS=Solanum lycopersicu... [more]
FER1_ARATH3.365e-3860.71Ferredoxin-1, chloroplastic OS=Arabidopsis thalian... [more]
FER1_MESCR2.793e-3765.48Ferredoxin-1, chloroplastic OS=Mesembryanthemum cr... [more]
FER_SILPR8.401e-3359.52Ferredoxin, chloroplastic OS=Silene pratensis GN=P... [more]
FER1_PEA1.534e-3160.71Ferredoxin-1, chloroplastic OS=Pisum sativum GN=PE... [more]
FER1_SPIOL3.650e-3061.90Ferredoxin-1, chloroplastic OS=Spinacia oleracea G... [more]
FER1_MAIZE1.365e-2962.79Ferredoxin-1, chloroplastic OS=Zea mays GN=FDX1 PE... [more]
FER_BRANA1.159e-2869.05Ferredoxin OS=Brassica napus PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-007-F10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665416 ID=EY665416|Name=EY665416|organism=Citrus sinensis|type=EST|length=1026bp
CAACTGTCCCTTCCTTGAGCAAGAGCAGCAACCATGGCCACCCTCTCAAG
CGCCATGGTCAGCACCTCATTCATCAGAAGCAAGCCTACAGCGACCAGCC
TCAAAGCCATGCCTAACATGGGTCAGGCTATATTTGGCCTCAAAGCCAAC
AGAGGTGGCCGTGTTGTAGCCATGGCTACATACAAAGTCAAGCTCATTAC
ACCTGAGGGGAGAGGAAGAAATCAACTGTCCTGATGACTCGTTTATTCTT
GATGCTGCTGAAGAAGCTGGGCTTGATCTTCCGTACTCATGCAGGGCTGG
GGCTTGCTCTTCCTGTACTGGGAAAGTTGTGTCTGGAACCGTTGACCAGT
CGGAGCAAAGCTCTCTGGATGATGATCAAATTGGAGAAAGGTTTTGTCTC
ACTTGTGCTGCTTATCCAACAAGTGATGTTACTATAGAGACTCACAAGGA
AGAGGAGCTCGCTGGTTATAATGTGCTCTTGAATCTCATAATATCTTCTC
TTTATGTGTTGTGTTTTGCTGATAATTTTATGCTTTGAAAGGAAATTGAG
TATTTGAGAAGATTCTGGAATGTGTTTTTATTCTTGTTGCAAAAAATTGT
TGAATTGCACCGGCCAGAATGCCCTCGACCTAAAAGGGGAGTTCCCCTCC
ATCCAAACTGGTACCTTTCAAATTAAAATTCAACAAAAACAAAATTTTCC
GATAAAAAATCCACAGATAAAAAAACAATAAAAAGATTGTAAAGAATGAA
GATGACGAGAAAAATGAAGTGAACCATGGACGTTGATGATGAAAAGAGAT
GGGGGGGGGGGGGCCTAGGAGAAATAAGGAGGGGGGGGTTCTCTCTTTAT
ATCCTATACATAACGTGGTATTGACGGGGGGGACCCTGTTCACATCCCCA
ATGAACACTTCTCAGGATAAAAAACCCCAAACTCCAATTACAAGTGGAAA
ACCCCTTGAATTATGGGAGGTCGTTATTACATATATCTGTCTTTTTTTCT
GCAANATAATAAGGAGTGTAAATATA
back to top