EY665411

Overview
NameEY665411
Unique NameEY665411
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length979
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665411 vs. ExPASy Swiss-Prot
Match: HSP7C_PETHY (Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 2.180e-91
Identity = 181/229 (79.04%), Postives = 187/229 (81.66%), Query Frame = 1
Query:   88 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEEQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISXLKCDAY*LTNPTAAAIALWAGKKRQEITG*KKKGPLF*IWGGGTFGRPPLFDPFEEGFF 774
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRFSDPSVQSD+KLWPFKVI G GDKPMIVV YKGEE+QF+AEEISSMVL KMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVI+ L      +  PTAAAIA    KK        +K  L    GGGTF    L    EEG F
Sbjct:    1 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAAEEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI-INEPTAAAIAYGLDKKASSA---GEKNVLIFDLGGGTFDVSLL--TIEEGIF 223          
BLAST of EY665411 vs. ExPASy Swiss-Prot
Match: HSP72_SOLLC (Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 2.411e-90
Identity = 180/229 (78.60%), Postives = 187/229 (81.66%), Query Frame = 1
Query:   88 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEEQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISXLKCDAY*LTNPTAAAIALWAGKKRQEITG*KKKGPLF*IWGGGTFGRPPLFDPFEEGFF 774
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRFSD SVQSDMKLWPFKVI G GDKPMIVVNYKGEE+QFSAEEISSMVL KMKEIAEA+LGTT+KNAVVTVPAY NDSQRQATKDAGVIS L      +  PTAAAIA    KK   +    +K  L    GGGTF    L    EEG F
Sbjct:    1 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSAEEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYSNDSQRQATKDAGVISGLNVMRI-INEPTAAAIAYGLDKKATSV---GEKNVLIFDLGGGTFDVSLL--TIEEGIF 223          
BLAST of EY665411 vs. ExPASy Swiss-Prot
Match: HSP71_SOLLC (Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 2.665e-89
Identity = 177/229 (77.29%), Postives = 186/229 (81.22%), Query Frame = 1
Query:   88 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEEQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISXLKCDAY*LTNPTAAAIALWAGKKRQEITG*KKKGPLF*IWGGGTFGRPPLFDPFEEGFF 774
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGRRFSD SVQ DMKLWPFKVI G GDKPMIVV YKGEE++F+AEEISSMVL KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVIS L      +  PTAAAIA    KK    T   +K  L    GGGTF    L    EEG F
Sbjct:    1 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVALNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAAEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI-INEPTAAAIAYGLDKK---ATSAGEKNVLIFDLGGGTFDVSLL--TIEEGIF 223          
BLAST of EY665411 vs. ExPASy Swiss-Prot
Match: HSP71_ARATH (Heat shock cognate 70 kDa protein 1 OS=Arabidopsis thaliana GN=HSC70-1 PE=1 SV=3)

HSP 1 Score: 323.939 bits (829), Expect = 8.574e-88
Identity = 174/229 (75.98%), Postives = 185/229 (80.79%), Query Frame = 1
Query:   88 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEEQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISXLKCDAY*LTNPTAAAIALWAGKKRQEITG*KKKGPLF*IWGGGTFGRPPLFDPFEEGFF 774
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRFSD SVQSDMKLWPFK+ AG  DKPMI V YKGEE++F+AEEISSMVL KM+EIAEAYLG TIKNAVVTVPAYFNDSQRQATKDAGVI+ L      +  PTAAAIA    KK   +    +K  L    GGGTF    L    EEG F
Sbjct:    1 MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAAEEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI-INEPTAAAIAYGLDKKATSV---GEKNVLIFDLGGGTFDVSLL--TIEEGIF 223          
BLAST of EY665411 vs. ExPASy Swiss-Prot
Match: HSP73_ARATH (Heat shock cognate 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSC70-3 PE=1 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 3.258e-87
Identity = 172/229 (75.11%), Postives = 187/229 (81.66%), Query Frame = 1
Query:   88 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEEQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISXLKCDAY*LTNPTAAAIALWAGKKRQEITG*KKKGPLF*IWGGGTFGRPPLFDPFEEGFF 774
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+D SVQSD+KLWPF + +G  +KPMIVVNYKGE+++FSAEEISSM+L KM+EIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVI+ L      +  PTAAAIA    KK   +    +K  L    GGGTF    L    EEG F
Sbjct:    1 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFTLKSGPAEKPMIVVNYKGEDKEFSAEEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI-INEPTAAAIAYGLDKKATSV---GEKNVLIFDLGGGTFDVSLL--TIEEGIF 223          
BLAST of EY665411 vs. ExPASy Swiss-Prot
Match: HSP72_ARATH (Heat shock cognate 70 kDa protein 2 OS=Arabidopsis thaliana GN=HSC70-2 PE=2 SV=2)

HSP 1 Score: 322.013 bits (824), Expect = 3.258e-87
Identity = 172/229 (75.11%), Postives = 186/229 (81.22%), Query Frame = 1
Query:   88 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEEQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISXLKCDAY*LTNPTAAAIALWAGKKRQEITG*KKKGPLF*IWGGGTFGRPPLFDPFEEGFF 774
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRFSD SVQSD +LWPF +I+G  +KPMIVV YKGEE+QF+AEEISSMVL KM+EIAEA+LGTT+KNAVVTVPAYFNDSQRQATKDAGVI+ L      +  PTAAAIA    KK   +    +K  L    GGGTF    L    EEG F
Sbjct:    1 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPVNTVFDAKRLIGRRFSDASVQSDRQLWPFTIISGTAEKPMIVVEYKGEEKQFAAEEISSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI-INEPTAAAIAYGLDKKATSV---GEKNVLIFDLGGGTFDVSLL--TIEEGIF 223          
BLAST of EY665411 vs. ExPASy Swiss-Prot
Match: HSP7E_SPIOL (Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3)

HSP 1 Score: 319.316 bits (817), Expect = 2.112e-86
Identity = 174/229 (75.98%), Postives = 186/229 (81.22%), Query Frame = 1
Query:   88 MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEEQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISXLKCDAY*LTNPTAAAIALWAGKKRQEITG*KKKGPLF*IWGGGTFGRPPLFDPFEEGFF 774
            MAGKGEGPAIGIDLGTTYS VGVWQHDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRFSD SVQ+DMK  PFKV++G G+KPMI VNYKGEE+QF+AEEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVIS L      +  PTAAAIA    KK   +    +K  L    GGGTF    L    EEG F
Sbjct:    1 MAGKGEGPAIGIDLGTTYSRVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDASVQADMKHRPFKVVSGPGEKPMIGVNYKGEEKQFAAEEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRI-INEPTAAAIAYGLDKKATSV---GEKNVLIFDLGGGTFDVSLL--TIEEGIF 223          
BLAST of EY665411 vs. ExPASy Swiss-Prot
Match: HSP70_MAIZE (Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 1.788e-85
Identity = 174/226 (76.99%), Postives = 183/226 (80.97%), Query Frame = 1
Query:   97 KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEEQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISXLKCDAY*LTNPTAAAIALWAGKKRQEITG*KKKGPLF*IWGGGTFGRPPLFDPFEEGFF 774
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFS P+VQS MKLWP + + G GDKPMIV NYKGEE+QF+AEEISSMVL KMKEIAEAYLG+TIKNAVVTVPAYFNDSQRQATKDAGVI+ L      +  PTAAAIA    KK    T   +K  L    GGGTF    L    EEG F
Sbjct:    3 KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSSPAVQSSMKLWPSRHL-GLGDKPMIVFNYKGEEKQFAAEEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRI-INEPTAAAIAYGLDKK---ATSSGEKNVLIFDLGGGTFDVSLL--TIEEGIF 221          
BLAST of EY665411 vs. ExPASy Swiss-Prot
Match: HSP70_SOYBN (Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 5.038e-80
Identity = 164/224 (73.21%), Postives = 175/224 (78.12%), Query Frame = 1
Query:  103 EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEEQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISXLKCDAY*LTNPTAAAIALWAGKKRQEITG*KKKGPLF*IWGGGTFGRPPLFDPFEEGFF 774
            EG AIGIDLGTTYSCVGVWQ+DRVEII NDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRFSD SVQ+DMKLWPFKV     DKPMIVVNYKGEE++FSAEEISSMVL KM+E+AEA+LG  +KNAVVTVPAYFNDSQRQATKDAG IS L      +  PTAAAIA    KK        ++  L    GGGTF    L    EEG F
Sbjct:    5 EGKAIGIDLGTTYSCVGVWQNDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRRFSDSSVQNDMKLWPFKVGGSPCDKPMIVVNYKGEEKKFSAEEISSMVLVKMREVAEAFLGHAVKNAVVTVPAYFNDSQRQATKDAGAISGLNVLRI-INEPTAAAIAYGLDKKASRK---GEQNVLIFDLGGGTFDVSIL--TIEEGIF 222          
BLAST of EY665411 vs. ExPASy Swiss-Prot
Match: HS7C1_DICDI (Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2)

HSP 1 Score: 287.73 bits (735), Expect = 6.809e-77
Identity = 156/207 (75.36%), Postives = 164/207 (79.23%), Query Frame = 1
Query:  112 AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEEQFSAEEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVISXLKCDAY*LTNPTAAAIALWAGKKRQEITG*KKKGPLF*IWGGGTF 732
            +IGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGR+FSD  VQSDMK WPFKVI   GDKP I V +KGE + FS EEISSMVL KMKE AEAYLG TI NAV+TVPAYFNDSQRQATKDAG IS L      +  PTAAAIA    KK     G  +K  L    GGGTF
Sbjct:    3 SIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRKFSDKEVQSDMKHWPFKVIPKDGDKPHIQVEFKGETKVFSPEEISSMVLLKMKETAEAYLGKTINNAVITVPAYFNDSQRQATKDAGTISKLNVQRI-INEPTAAAIAYGLEKK-----GSGEKNILIFDLGGGTF 203          
The following BLAST results are available for this feature:
BLAST of EY665411 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP7C_PETHY2.180e-9179.04Heat shock cognate 70 kDa protein OS=Petunia hybri... [more]
HSP72_SOLLC2.411e-9078.60Heat shock cognate 70 kDa protein 2 OS=Solanum lyc... [more]
HSP71_SOLLC2.665e-8977.29Heat shock cognate 70 kDa protein 1 OS=Solanum lyc... [more]
HSP71_ARATH8.574e-8875.98Heat shock cognate 70 kDa protein 1 OS=Arabidopsis... [more]
HSP73_ARATH3.258e-8775.11Heat shock cognate 70 kDa protein 3 OS=Arabidopsis... [more]
HSP72_ARATH3.258e-8775.11Heat shock cognate 70 kDa protein 2 OS=Arabidopsis... [more]
HSP7E_SPIOL2.112e-8675.98Chloroplast envelope membrane 70 kDa heat shock-re... [more]
HSP70_MAIZE1.788e-8576.99Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=... [more]
HSP70_SOYBN5.038e-8073.21Heat shock 70 kDa protein OS=Glycine max GN=HSP70 ... [more]
HS7C1_DICDI6.809e-7775.36Heat shock cognate 70 kDa protein 1 OS=Dictyosteli... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-007-F05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665411 ID=EY665411|Name=EY665411|organism=Citrus sinensis|type=EST|length=979bp
CAATCAATAAGTAAACACTAAAGCTCGCAAATCATCCGTGCTTTTTTTCT
TTTTTTATTGTTGATAGATTCTTGATTTTGTTAATCGATGGCTGGAAAAG
GCGAAGGTCCTGCTATTGGAATTGACTTGGGCACGACTTACTCCTGTGTC
GGTGTGTGGCAACATGATCGAGTTGAGATCATCGCTAATGATCAAGGTAA
CCGAACGACGCCGTCTTATGTGGCGTTTACTGACACTGAGCGTTTGATCG
GTGACGCTGCCAAGAACCAGGTCGCCATGAACCCCACCAACACTGTTTTT
GATGCTAAGCGTTTGATTGGGAGGCGATTCAGTGATCCTTCAGTACAGAG
TGACATGAAACTATGGCCGTTCAAGGTCATTGCTGGAGCAGGTGACAAGC
CTATGATCGTTGTCAATTACAAAGGCGAAGAAGAGCAATTTTCTGCGGAA
GAAATCTCCTCAATGGTTCTTAATAAGATGAAAGAGATTGCTGAGGCTTA
TCTGGGCACTACTATTAAGAATGCTGTTGTCACAGTACCTGCTTACTTTA
ATGACTCACAGCGTCAAGCCACGAAGGACGCTGGTGTTATTTCTTNCCTT
AAATGTGATGCGTATTAATTAACGAACCCAACAGCTGCTGCTATTGCTTT
ATGGGCTGGAAAAAAAAGGCAGGAAATAACTGGGTGAAAAAAAAAGGGGC
CCCTTTTTTGAATCTGGGGGGGGGGAACTTTTGGAAGGCCCCCCCTTTTT
GACCCTTTTGAGGAAGGGTTTTTTTCCAAAATGGAAAGGCCTCCTGGGCG
GGGGGAAAACCCCCCTTTGGGGAAGGGTGAAAAAAATTTTTGAACAAACC
AAAAAGGGGGGAAAACCCCCTTTTTGTTTTCTCAGAAAAATTTTCAAAAA
AAAAGGAAAAAAAAAAACAAAAAAAAAGGGGAAAATTTTTTATATGGGGG
GAAAAAAACCCCCCCCCACACAAAAAAGC
back to top