EY665404

Overview
NameEY665404
Unique NameEY665404
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1039
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY665404_ssr928 microsatellite EY665404_ssr928:928..937. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY665404 vs. ExPASy Swiss-Prot
Match: TF2H4_DICDI (General transcription factor IIH subunit 4 OS=Dictyostelium discoideum GN=gtf2h4 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 6.350e-28
Identity = 63/160 (39.38%), Postives = 100/160 (62.50%), Query Frame = 2
Query:   11 FIPTKLATNLSMSLTDS-----------SARKEGFIVVETNFRMYAYSTSKLHCEILRLFSKVEYQLPNLIVGAITKESLYNAFENGITAEQIISFLQQNAHPRVADRMPSVPENVCDQIRLWESDLNRVEMTPAHYYDEFPSRDVFESCL*LCKRSKWF 457
            F PT+L  +L+   T S           + +++G+IV+ETN+R+YAY++S L   +L LF K+ Y+LPNL VG IT+ES+  A  +GITA+QII F++ N+HP  A+    +P+ V +QI LWE++ NR+  T +  Y+ FP+ D + + L   K   ++
Sbjct:  295 FYPTRLIISLTTGKTLSLIQSISSERTQTQKEQGYIVLETNYRLYAYTSSSLQISLLSLFVKMLYRLPNLAVGIITRESIRTALIHGITADQIIDFVRHNSHPNAANSGQPIPDVVAEQILLWEAERNRITYTKSVLYNSFPTNDCYIATLKFAKEQDYY 454          
BLAST of EY665404 vs. ExPASy Swiss-Prot
Match: TF2H4_PANTR (General transcription factor IIH subunit 4 OS=Pan troglodytes GN=GTF2H4 PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.415e-27
Identity = 61/142 (42.96%), Postives = 95/142 (66.90%), Query Frame = 2
Query:   11 FIPTKLATNLSMSLTDS--SARKEGFIVVETNFRMYAYSTSKLHCEILRLFSKVEYQLPNLIVGAITKESLYNAFENGITAEQIISFLQQNAHPRVADRMPSVPENVCDQIRLWESDLNRVEMTPAHYYDEFPSRDVFESCL 430
            + PT+LA NLS  ++ +  +  + GFIVVETN+R+YAY+ S+L   ++ LFS++ Y+ PN++V  +T+ES+  A  +GITA+QII FL+  AHP +  + P +P  + DQIRLWE + +R+  T    Y++F S+  FE  L
Sbjct:  281 YYPTRLAINLSSGVSGAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLL 422          
BLAST of EY665404 vs. ExPASy Swiss-Prot
Match: TF2H4_HUMAN (General transcription factor IIH subunit 4 OS=Homo sapiens GN=GTF2H4 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.415e-27
Identity = 61/142 (42.96%), Postives = 95/142 (66.90%), Query Frame = 2
Query:   11 FIPTKLATNLSMSLTDS--SARKEGFIVVETNFRMYAYSTSKLHCEILRLFSKVEYQLPNLIVGAITKESLYNAFENGITAEQIISFLQQNAHPRVADRMPSVPENVCDQIRLWESDLNRVEMTPAHYYDEFPSRDVFESCL 430
            + PT+LA NLS  ++ +  +  + GFIVVETN+R+YAY+ S+L   ++ LFS++ Y+ PN++V  +T+ES+  A  +GITA+QII FL+  AHP +  + P +P  + DQIRLWE + +R+  T    Y++F S+  FE  L
Sbjct:  281 YYPTRLAINLSSGVSGAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLL 422          
BLAST of EY665404 vs. ExPASy Swiss-Prot
Match: TF2H4_MOUSE (General transcription factor IIH subunit 4 OS=Mus musculus GN=Gtf2h4 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.847e-27
Identity = 61/142 (42.96%), Postives = 95/142 (66.90%), Query Frame = 2
Query:   11 FIPTKLATNLSMSLTDS--SARKEGFIVVETNFRMYAYSTSKLHCEILRLFSKVEYQLPNLIVGAITKESLYNAFENGITAEQIISFLQQNAHPRVADRMPSVPENVCDQIRLWESDLNRVEMTPAHYYDEFPSRDVFESCL 430
            + PT+LA NLS  ++ +  +  + GFIVVETN+R+YAY+ S+L   ++ LFS++ Y+ PN++V  +T+ES+  A  +GITA+QII FL+  AHP +  + P +P  + DQIRLWE + +R+  T    Y++F S+  FE  L
Sbjct:  282 YYPTRLAINLSSGVSGAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQNPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLL 423          
BLAST of EY665404 vs. ExPASy Swiss-Prot
Match: TFB2_SCHPO (RNA polymerase II transcription factor B subunit 2 OS=Schizosaccharomyces pombe GN=tfb2 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 6.571e-25
Identity = 57/146 (39.04%), Postives = 90/146 (61.64%), Query Frame = 2
Query:   11 FIPTKLATNLSMSLTDSSARK------EGFIVVETNFRMYAYSTSKLHCEILRLFSKVEYQLPNLIVGAITKESLYNAFENGITAEQIISFLQQNAHPRVADRMPSVPENVCDQIRLWESDLNRVEMTPAHYYDEFPSRDVFESCL 430
            F PT+LAT L+        ++      +GFI+VETN+R+YAY++S L   I+ LF+ +  +  NL+VG IT++S+  A  NGI AEQII++L  +AHP++   +P +P  + DQI LWE + NR+  TP   + +F +   F+  +
Sbjct:  263 FYPTRLATGLTTDYRSLHGKQSENDDDKGFIIVETNYRLYAYTSSPLQIAIIGLFANLRARFSNLVVGVITRDSIRRALMNGIAAEQIITYLTTHAHPQMRSNVPLLPPTLVDQIYLWELEKNRLRATPGILFRDFLTDSGFDQAV 408          
BLAST of EY665404 vs. ExPASy Swiss-Prot
Match: TFB2_YARLI (RNA polymerase II transcription factor B subunit 2 OS=Yarrowia lipolytica GN=TFB2 PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.695e-23
Identity = 56/155 (36.13%), Postives = 90/155 (58.06%), Query Frame = 2
Query:   11 FIPTKLATNLSM------------------SLTDSSARKEGFIVVETNFRMYAYSTSKLHCEILRLFSKVEYQLPNLIVGAITKESLYNAFENGITAEQIISFLQQNAHPRVADRMPSVPENVCDQIRLWESDLNRVEMTPAHYYDEFPSRDVFE 421
            F PT+LAT L+                   +++ S A   GFI++ETNFR+YAY+ S L   +L LF  ++ +  N++ G I ++S+  A  NGITAEQII++L  +AHPR+      +P  V DQI+LW+ +++R+  T  + + EF + D ++
Sbjct:  265 FYPTRLATTLTSETAALRTASQSMEAATQDTISSSVAADSGFIILETNFRLYAYTESPLQIAVLNLFVNLKTRFANMVTGQINRDSVRFALSNGITAEQIITYLSVHAHPRMKGMEHVLPPTVVDQIKLWQLEMDRIRATDGYLFSEFKNFDEYK 419          

HSP 2 Score: 21.1718 bits (43), Expect = 1.695e-23
Identity = 11/42 (26.19%), Postives = 21/42 (50.00%), Query Frame = 3
Query:  420 KAACDYARDQSGLLWEDPKKMRLVVKAKIHMHMKESLRGQNK 545
            K    YA++   LL+E+P K + V        + E ++ +N+
Sbjct:  419 KDVSTYAKELGVLLYENPGKRKFVSTLAGSQQIVEFVKRRNQ 460          
BLAST of EY665404 vs. ExPASy Swiss-Prot
Match: TFB2_KLULA (RNA polymerase II transcription factor B subunit 2 OS=Kluyveromyces lactis GN=TFB2 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.252e-21
Identity = 49/136 (36.03%), Postives = 81/136 (59.56%), Query Frame = 2
Query:   71 KEGFIVVETNFRMYAYSTSKLHCEILRLFSKVEYQLPNLIVGAITKESLYNAFENGITAEQIISFLQQNAHPR------------------VADRMPSVPENVCDQIRLWESDLNRVEMTPAHYYDEFPSRDVFES 424
            ++G +++ETNF++Y+YS S L   IL LF  ++ +  N++ G +T+ES+ NA  NGITAEQII++L+ +AHPR                  V + +  +P  V DQIRLW+ +L+R+     + Y +F S   +++
Sbjct:  320 QDGALIIETNFKLYSYSNSPLQIAILSLFVHLKSRFANMVTGQLTRESVRNALLNGITAEQIIAYLETHAHPRMRRLAEENLSKKLELDPTVKETLQVLPPTVVDQIRLWQLELDRIISYDGYLYTDFESYQEYQT 455          

HSP 2 Score: 25.0238 bits (53), Expect = 4.252e-21
Identity = 10/28 (35.71%), Postives = 15/28 (53.57%), Query Frame = 3
Query:  420 KAACDYARDQSGLLWEDPKKMRLVVKAK 503
            +   DYA+D   LLW++ KK    V  +
Sbjct:  454 QTVADYAKDIGVLLWQNEKKKMFFVSTE 481          
BLAST of EY665404 vs. ExPASy Swiss-Prot
Match: TFB2_ASHGO (RNA polymerase II transcription factor B subunit 2 OS=Ashbya gossypii GN=TFB2 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.378e-18
Identity = 44/134 (32.84%), Postives = 78/134 (58.21%), Query Frame = 2
Query:   74 EGFIVVETNFRMYAYSTSKLHCEILRLFSKVEYQLPNLIVGAITKESLYNAFENGITAEQIISFLQQNAHPRV------------------ADRMPSVPENVCDQIRLWESDLNRVEMTPAHYYDEFPSRDVFE 421
            +G ++VETNF++Y+YS S L   IL LF  ++ +  N++ G IT+ES+  A  NGITA+QII++++ +AHP++                   D +  +P  V DQI+LW+ +L+R+     + + +F +   ++
Sbjct:  338 DGALIVETNFKLYSYSNSPLQIAILSLFIHLKTRFQNMVTGQITRESIRRALHNGITADQIIAYMETHAHPQMRRLAGDNLEKKLELDPNCRDTLQVLPPTVVDQIKLWQLELDRIISYDGYLFRDFDNLQEYQ 471          

HSP 2 Score: 24.2534 bits (51), Expect = 1.378e-18
Identity = 11/20 (55.00%), Postives = 11/20 (55.00%), Query Frame = 3
Query:  435 YARDQSGLLWEDPKKMRLVV 494
            YARD   LLW D KK    V
Sbjct:  476 YARDIGVLLWSDDKKKMFFV 495          
BLAST of EY665404 vs. ExPASy Swiss-Prot
Match: TFB2_YEAST (RNA polymerase II transcription factor B subunit 2 OS=Saccharomyces cerevisiae GN=TFB2 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.792e-18
Identity = 46/127 (36.22%), Postives = 75/127 (59.06%), Query Frame = 2
Query:   74 EGFIVVETNFRMYAYSTSKLHCEILRLFSKVEYQLPNLIVGAITKESLYNAFENGITAEQIISFLQQNAHPRV------------------ADRMPSVPENVCDQIRLWESDLNRVEMTPAHYYDEF 400
            +G ++VETNF++Y+YS S L   +L LF  ++ +  N+++G IT+ES+  A  NGITA+QII++L+ +AHP++                   + +  +P  V DQIRLW+ +L+RV       Y +F
Sbjct:  336 DGSLIVETNFKIYSYSNSPLQIAVLSLFVHLKARFVNMVLGQITRESIRRALTNGITADQIIAYLETHAHPQMRRLAEEKLEKKLELDPNCKEPLQVLPPTVVDQIRLWQLELDRVITYEGSLYSDF 462          

HSP 2 Score: 23.8682 bits (50), Expect = 1.792e-18
Identity = 9/20 (45.00%), Postives = 13/20 (65.00%), Query Frame = 3
Query:  435 YARDQSGLLWEDPKKMRLVV 494
            YA+D   LLW+D KK +  +
Sbjct:  474 YAQDIGVLLWKDDKKKKFFI 493          
BLAST of EY665404 vs. ExPASy Swiss-Prot
Match: TFB2_CANGA (RNA polymerase II transcription factor B subunit 2 OS=Candida glabrata GN=TFB2 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.956e-17
Identity = 48/142 (33.80%), Postives = 79/142 (55.63%), Query Frame = 2
Query:   71 KEGFIVVETNFRMYAYSTSKLHCEILRLFSKVEYQLPNLIVGAITKESLYNAFENGITAEQIISFLQQNAHPRV------------------ADRMPSVPENVCDQIRLWESDLNRVEMTPAHYYDEFPSRDVFESCL*LCK 442
            ++G +++ETNF++Y+Y  S L   IL LF  ++ +  N++ G IT+ES+  A  NGITA+Q+I++L+ +AHP++                   D +  +P  V DQI+LW+ +L+RV       Y +F +   F     LCK
Sbjct:  325 QDGALIIETNFKLYSYCNSPLQIAILSLFVHLKSRFANMVAGQITRESIRRALINGITADQVIAYLESHAHPQMRRLAEEKLQKKLELDPNCKDPLQVLPPTVVDQIKLWQLELDRVLTYEGSLYIDFDTAQDFNM---LCK 463          
The following BLAST results are available for this feature:
BLAST of EY665404 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
TF2H4_DICDI6.350e-2839.38General transcription factor IIH subunit 4 OS=Dict... [more]
TF2H4_PANTR1.415e-2742.96General transcription factor IIH subunit 4 OS=Pan ... [more]
TF2H4_HUMAN1.415e-2742.96General transcription factor IIH subunit 4 OS=Homo... [more]
TF2H4_MOUSE1.847e-2742.96General transcription factor IIH subunit 4 OS=Mus ... [more]
TFB2_SCHPO6.571e-2539.04RNA polymerase II transcription factor B subunit 2... [more]
TFB2_YARLI1.695e-2336.13RNA polymerase II transcription factor B subunit 2... [more]
TFB2_KLULA4.252e-2136.03RNA polymerase II transcription factor B subunit 2... [more]
TFB2_ASHGO1.378e-1832.84RNA polymerase II transcription factor B subunit 2... [more]
TFB2_YEAST1.792e-1836.22RNA polymerase II transcription factor B subunit 2... [more]
TFB2_CANGA2.956e-1733.80RNA polymerase II transcription factor B subunit 2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-007-E07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665404 ID=EY665404|Name=EY665404|organism=Citrus sinensis|type=EST|length=1039bp
AGAGAATTGGTTTATACCTACTAAATTAGCTACCAATCTTTCAATGAGCT
TAACTGATTCATCAGCACGGAAAGAGGGATTTATTGTAGTGGAAACAAAC
TTCAGGATGTATGCTTATTCAACATCTAAGCTACACTGTGAAATTTTGCG
TCTTTTCTCAAAGGTAGAGTATCAACTTCCAAACCTTATAGTTGGAGCAA
TAACCAAAGAAAGCTTGTATAATGCTTTTGAGAATGGGATTACTGCTGAG
CAGATAATTAGTTTTCTTCAGCAAAATGCACATCCTCGGGTTGCTGACAG
AATGCCATCCGTACCAGAAAATGTCTGTGATCAGATAAGATTGTGGGAAT
CAGATCTGAATAGGGTTGAGATGACCCCTGCTCATTATTATGATGAGTTT
CCCTCTAGGGATGTCTTTGAAAGCTGCTTGTGACTATGCAAGAGATCAAA
GTGGTTTGCTATGGGAGGATCCAAAGAAAATGCGTCTAGTCGTTAAAGCA
AAAATTCACATGCACATGAAAGAGTCCCTTCGGGGTCAAAACAAGTAAAA
AGATATGTTTTCTTGGACCTGCCAAAACTTAATGAAACAAAAAAGATGGA
CAGGCCTGGTCTTGGTTGGGGAGGGTTGCAGGGTAACCTTTGTTAAAATT
TGGAAATTTTTTTTTTTTTTTTGGGCCCAATTTTGATTCGGCTTTAAAAC
TTCCCAAAAGGATTTTTCCCAAAATTCTTTGAAAAACCAAAAAGGGGAAA
AAAAAAAAAAAACAAAAATTTTTTTTTCCCCCCCGAAAAAAAAAAAAGAG
GGGGGGGTGTGAAAAGTCCCCGGGAAAAAACCTTCTCTTTATCCCCCCAA
ATTTGGGGGGGGGGAAAGAGGTTCCCCCTAAAAAAAAAAAAGAAGAAAAA
AAAGAAAAAAAGGGGGTTTGGTGTTTTTCTCTCTCTCCCGTGGAAATCTT
TTTTTAATTTTTTTAATTTTTTAAATTTTTAAAAATTATTCACGGAAAAA
AAAGAGGGAAAAAAAAGAGAAGGGGGGAGAAAATTGTCT
back to top