CX069494

Overview
NameCX069494
Unique NameCX069494
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length468
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX069494 vs. ExPASy Swiss-Prot
Match: VPS35_MOUSE (Vacuolar protein sorting-associated protein 35 OS=Mus musculus GN=Vps35 PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.356e-23
Identity = 66/159 (41.51%), Postives = 94/159 (59.12%), Query Frame = 3
Query:    3 KAQVTAIHLIIGTLQRISVFGIENRDTLTHKATGYSARLLKKPDQCRAVYACSHLFWV---DDQDG--IKDGERVLLCLKRALRIANAAQQMANVARGSSGPVVLFVEILNKYLYFFEKGNTQITASAIQSLIELITSEMKS-ESTTLDPADNAFFAST 461
            KAQ+ AI LIIGT +R+  F  EN + L  +    +++LLKKPDQ RAV  C+HLFW     D++G  +  G+RV+ CLK+AL+IAN            S  V LF+EILN+Y+YF+EK N  +T   +  LI+ I  ++ + ES+      N  F +T
Sbjct:  622 KAQLAAITLIIGTFERMKCFSEENHEPLRTQCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGKRVMECLKKALKIANQCMD-------PSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIREDLPNLESSEETEQINKHFHNT 773          
BLAST of CX069494 vs. ExPASy Swiss-Prot
Match: VPS35_HUMAN (Vacuolar protein sorting-associated protein 35 OS=Homo sapiens GN=VPS35 PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.356e-23
Identity = 66/159 (41.51%), Postives = 94/159 (59.12%), Query Frame = 3
Query:    3 KAQVTAIHLIIGTLQRISVFGIENRDTLTHKATGYSARLLKKPDQCRAVYACSHLFWV---DDQDG--IKDGERVLLCLKRALRIANAAQQMANVARGSSGPVVLFVEILNKYLYFFEKGNTQITASAIQSLIELITSEMKS-ESTTLDPADNAFFAST 461
            KAQ+ AI LIIGT +R+  F  EN + L  +    +++LLKKPDQ RAV  C+HLFW     D++G  +  G+RV+ CLK+AL+IAN            S  V LF+EILN+Y+YF+EK N  +T   +  LI+ I  ++ + ES+      N  F +T
Sbjct:  622 KAQLAAITLIIGTFERMKCFSEENHEPLRTQCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGKRVMECLKKALKIANQCMD-------PSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIREDLPNLESSEETEQINKHFHNT 773          
BLAST of CX069494 vs. ExPASy Swiss-Prot
Match: VPS35_BOVIN (Vacuolar protein sorting-associated protein 35 OS=Bos taurus GN=VPS35 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.356e-23
Identity = 66/159 (41.51%), Postives = 94/159 (59.12%), Query Frame = 3
Query:    3 KAQVTAIHLIIGTLQRISVFGIENRDTLTHKATGYSARLLKKPDQCRAVYACSHLFWV---DDQDG--IKDGERVLLCLKRALRIANAAQQMANVARGSSGPVVLFVEILNKYLYFFEKGNTQITASAIQSLIELITSEMKS-ESTTLDPADNAFFAST 461
            KAQ+ AI LIIGT +R+  F  EN + L  +    +++LLKKPDQ RAV  C+HLFW     D++G  +  G+RV+ CLK+AL+IAN            S  V LF+EILN+Y+YF+EK N  +T   +  LI+ I  ++ + ES+      N  F +T
Sbjct:  622 KAQLAAITLIIGTFERMKCFSEENHEPLRTQCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGKRVMECLKKALKIANQCMD-------PSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIREDLPNLESSEETEQINKHFHNT 773          
BLAST of CX069494 vs. ExPASy Swiss-Prot
Match: VPS35_SCHPO (Vacuolar protein sorting-associated protein 35 OS=Schizosaccharomyces pombe GN=vps35 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.513e-19
Identity = 51/139 (36.69%), Postives = 79/139 (56.83%), Query Frame = 3
Query:    9 QVTAIHLIIGTLQRISVFGIENRDTLTHKATGYSARLLKKPDQCRAVYACSHLFWV----DDQDGIKDGERVLLCLKRALRIANAAQQMANVARGSSGPVVLFVEILNKYLYFFEKGNTQITASAIQSLIELITSEMKS 413
            Q   + +IIG LQ+   F +++ DTL  K T Y+++LLKKPDQC  +Y  SHL+W     +D    +D +RVL CL+++L+IA+A        +       LF+ IL +Y Y++++    I A  I  LI+L    M+S
Sbjct:  596 QYQQLLMIIGKLQKTRNFSVDDYDTLITKCTLYASKLLKKPDQCCGIYLASHLWWQVASGEDSRPFQDPKRVLECLQKSLKIADACMDQLTSLK-------LFINILERYFYYYDQHCESIIAKHISGLIDLTEQNMRS 727          
BLAST of CX069494 vs. ExPASy Swiss-Prot
Match: VPS35_YEAST (Vacuolar protein sorting-associated protein 35 OS=Saccharomyces cerevisiae GN=VPS35 PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 6.517e-18
Identity = 58/152 (38.16%), Postives = 89/152 (58.55%), Query Frame = 3
Query:    3 KAQVTAIHLIIGTLQRI-SVFGIENRDTLTHKATGYSARLLKKPDQCRAVYACSHLFW------VDDQDGI-----KDGERVLLCLKRALRIANAAQQMANVARGSSGPVVLFVEILNKYLYFF---EKGNTQITASAIQSLIELITSEMKS 413
            K Q+ A+  I  +LQ+  S++     D+L  + T + ++LLKK DQCRAVY CSHL+W      + +++GI     +DG+RVL CL+R+LR+A++          +     L VEILN+ LY+F   ++  T I+   I  LIELI + +KS
Sbjct:  688 KTQLQALIYIAQSLQKTRSLYKEAYYDSLIVRCTLHGSKLLKKQDQCRAVYLCSHLWWATEISNIGEEEGITDNFYRDGKRVLECLQRSLRVADSIMD-------NEQSCELMVEILNRCLYYFIHGDESETHISIKYINGLIELIKTNLKS 832          
BLAST of CX069494 vs. ExPASy Swiss-Prot
Match: VPS35_DICDI (Vacuolar sorting protein 35 OS=Dictyostelium discoideum GN=vps35 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.700e-13
Identity = 49/146 (33.56%), Postives = 78/146 (53.42%), Query Frame = 3
Query:    3 KAQVTAIHLIIGTLQRISVFGIENRDTLTHKATGYSARLLKKPDQCRAVYACSHLFWVDDQD-GIKDGERVLLCLKRALRIANAAQQMANVARGSSGPVVLFVEILNKYLYFFEKGNTQITASAIQSLIELITSEMKSESTTLDPA 437
            KAQV A+ L+I TL  +S+   E  ++L  +    ++RLL   DQ + +  CSHLFWVD+     ++ + VL  LK+AL I         ++  SS  +  FV+ILN+ L++ +K    +    +  L+ELI +    E+   DPA
Sbjct:  627 KAQVMALQLLISTLNSLSIPNEEIYESLAAQTIKQASRLLLPQDQAKLISTCSHLFWVDNPSRQYQNPDSVLQALKKALSI---------ISNESSPGLGTFVDILNECLFYCDKETDAVPIQFVSDLVELIRTTHVKEA---DPA 760          
The following BLAST results are available for this feature:
BLAST of CX069494 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
VPS35_MOUSE1.356e-2341.51Vacuolar protein sorting-associated protein 35 OS=... [more]
VPS35_HUMAN1.356e-2341.51Vacuolar protein sorting-associated protein 35 OS=... [more]
VPS35_BOVIN1.356e-2341.51Vacuolar protein sorting-associated protein 35 OS=... [more]
VPS35_SCHPO4.513e-1936.69Vacuolar protein sorting-associated protein 35 OS=... [more]
VPS35_YEAST6.517e-1838.16Vacuolar protein sorting-associated protein 35 OS=... [more]
VPS35_DICDI3.700e-1333.56Vacuolar sorting protein 35 OS=Dictyostelium disco... [more]
back to top
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-2cdna_library
Properties
Property NameValue
Genbank descriptionUCRCS08_10G09_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA clone UCRCS08-10G09-M18-1-4.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX069494 ID=CX069494|Name=CX069494|organism=Citrus sinensis|type=EST|length=468bp
CCAAAGCCCAGGTGACAGCAATACATCTGATAATTGGAACTCTACAGAGG
ATAAGTGTATTTGGTATTGAGAATAGGGATACTTTGACACACAAGGCCAC
TGGGTATTCTGCAAGGCTTTTAAAGAAACCCGATCAGTGCCGAGCAGTTT
ATGCATGCTCACATCTCTTTTGGGTTGATGATCAAGATGGTATTAAGGAC
GGAGAAAGGGTCCTCCTATGCCTAAAGCGTGCCTTGAGGATTGCGAATGC
TGCTCAACAAATGGCCAATGTTGCACGGGGTAGCAGCGGGCCTGTAGTTC
TCTTTGTTGAAATACTTAACAAGTACCTCTATTTTTTTGAGAAAGGAAAC
ACACAGATCACAGCTTCAGCAATACAAAGCCTCATTGAGTTAATCACTAG
TGAGATGAAGAGTGAGTCAACAACCCTAGATCCTGCTGATAATGCTTTCT
TTGCGAGCACGAAACGGT
back to top