CV884662

Overview
NameCV884662
Unique NameCV884662
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length619
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Library UCRCS04-UCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CV884662 vs. ExPASy Swiss-Prot
Match: NRAM2_ARATH (Metal transporter Nramp2 OS=Arabidopsis thaliana GN=NRAMP2 PE=2 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 8.835e-64
Identity = 124/161 (77.02%), Postives = 136/161 (84.47%), Query Frame = 2
Query:  149 ETNRLLPIPSPPS----STEDDEEVAFDSREKILIVDADSASTLNVDGDQVPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLMWATLMGLLIQLLSARVGVATGRHLAELCREEYPNWARFVLWFMAEVALIGADFQEVIGSAIAI 619
            E +RLLP P PPS    ST+ + E AF++ EKILIVD +S       GD  PPFSW+KLWLFTGPGFLMSIAFLDPGNLEGDLQ+GAIAGYSLLWLLMWAT MGLLIQ+LSARVGVATGRHLAELCR+EYP WAR+VLW MAE+ALIGAD QEVIGSAIAI
Sbjct:   12 EEDRLLP-PPPPSQSLPSTDSESEAAFETNEKILIVDFESPDDPTT-GDTPPPFSWRKLWLFTGPGFLMSIAFLDPGNLEGDLQAGAIAGYSLLWLLMWATAMGLLIQMLSARVGVATGRHLAELCRDEYPTWARYVLWSMAELALIGADIQEVIGSAIAI 170          
BLAST of CV884662 vs. ExPASy Swiss-Prot
Match: NRAM3_ARATH (Metal transporter Nramp3 OS=Arabidopsis thaliana GN=NRAMP3 PE=2 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 1.236e-57
Identity = 109/144 (75.69%), Postives = 121/144 (84.03%), Query Frame = 2
Query:  194 EDDEEVAFDSREKILIVDADSASTLN--VDGDQVPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLMWATLMGLLIQLLSARVGVATGRHLAELCREEYPNWARFVLWFMAEVALIGADFQEVIGSAIAI 619
            E++EE A+D  EK+ IV  +    L   V     PPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQ+GA+AGYSLLWLLMWAT MGLL+QLLSAR+GVATGRHLAELCR+EYP WAR VLW MAE+ALIG+D QEVIGSAIAI
Sbjct:   15 EEEEETAYDETEKVHIVRNEEEDDLEHGVGCGGAPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQAGAVAGYSLLWLLMWATAMGLLVQLLSARLGVATGRHLAELCRDEYPTWARMVLWVMAELALIGSDIQEVIGSAIAI 158          
BLAST of CV884662 vs. ExPASy Swiss-Prot
Match: NRAM5_ARATH (Metal transporter Nramp5 OS=Arabidopsis thaliana GN=NRAMP5 PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 2.108e-57
Identity = 115/174 (66.09%), Postives = 134/174 (77.01%), Query Frame = 2
Query:  104 SSETREEESGSK--DSNETNRLLPIPSPPSSTEDDEEVAFDSREKILIVDADSASTLNVDGDQVPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLMWATLMGLLIQLLSARVGVATGRHLAELCREEYPNWARFVLWFMAEVALIGADFQEVIGSAIAI 619
            S+ +R+E S  +  DSN   + L +P   S  E+DE        +IL V+ D   T     D VPPFSW KLW FTGPGFLMSIAFLDPGN+EGDLQ+GA+AGYSLLWLL+WATLMGLL+QLLSAR+GVATGRHLAE+CR EYP+WAR +LWFMAEVALIGAD QEVIGSAIA+
Sbjct:    4 STVSRQENSPKRPNDSNGEFKRLLVPET-SQPEEDELHESPPENQILNVEEDRDKTY----DSVPPFSWAKLWKFTGPGFLMSIAFLDPGNIEGDLQAGAVAGYSLLWLLLWATLMGLLMQLLSARIGVATGRHLAEICRSEYPSWARILLWFMAEVALIGADIQEVIGSAIAL 172          
BLAST of CV884662 vs. ExPASy Swiss-Prot
Match: NRAM4_ARATH (Metal transporter Nramp4 OS=Arabidopsis thaliana GN=NRAMP4 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 3.595e-57
Identity = 113/160 (70.62%), Postives = 126/160 (78.75%), Query Frame = 2
Query:  146 NETNRLLPIPSPPSSTEDDEEVAFDSREKILIVDADSASTLNVDGD--QVPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLMWATLMGLLIQLLSARVGVATGRHLAELCREEYPNWARFVLWFMAEVALIGADFQEVIGSAIAI 619
            +ET+R  P+ +        EE A++  EK+LIV  D     + D D    P FSWKKLWLFTGPGFLMSIAFLDPGNLE DLQ+GAIAGYSL+WLLMWAT +GLLIQLLSAR+GVATGRHLAELCREEYP WAR VLW MAE+ALIGAD QEVIGSAIAI
Sbjct:    2 SETDRERPLLA-------SEERAYEETEKVLIVGIDEEEDADYDDDPGNSPKFSWKKLWLFTGPGFLMSIAFLDPGNLESDLQAGAIAGYSLIWLLMWATAIGLLIQLLSARLGVATGRHLAELCREEYPTWARMVLWIMAEIALIGADIQEVIGSAIAI 154          
BLAST of CV884662 vs. ExPASy Swiss-Prot
Match: NRAM2_MOUSE (Natural resistance-associated macrophage protein 2 OS=Mus musculus GN=Slc11a2 PE=1 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 3.058e-40
Identity = 92/183 (50.27%), Postives = 119/183 (65.03%), Query Frame = 2
Query:   98 MDSSETREEESGSKDSNETNRLLPI------PSPPSSTEDDEE---VAFDSREKILIVDADSASTLNVDGDQVPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLMWATLMGLLIQLLSARVGVATGRHLAELCREEYPNWARFVLWFMAEVALIGADFQEVIGSAIAI 619
            +D  E   ++  S D  ++  L  I       S P ST D EE     FD  EKI I + + +            FS++KLW FTGPGFLMSIA+LDPGN+E DLQSGA+AG+ LLW+L+ AT++GLL+Q L+AR+GV TG HLAE+C  +YP   R +LW M E+A+IG+D QEVIGSAIAI
Sbjct:    3 LDPKEKMPDDGASGDHGDSASLGAINPAYSNSSLPHSTGDSEEPFTTYFD--EKIPIPEEEYSC-----------FSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWVLLLATIVGLLLQRLAARLGVVTGLHLAEVCHRQYPKVPRIILWLMVELAIIGSDMQEVIGSAIAI 172          
BLAST of CV884662 vs. ExPASy Swiss-Prot
Match: MVL_DROME (Protein Malvolio OS=Drosophila melanogaster GN=Mvl PE=2 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 3.994e-40
Identity = 79/136 (58.09%), Postives = 103/136 (75.74%), Query Frame = 2
Query:  212 AFDSREKILIVDADSASTLNVDGDQVPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLMWATLMGLLIQLLSARVGVATGRHLAELCREEYPNWARFVLWFMAEVALIGADFQEVIGSAIAI 619
            A+ S EK+LI D DS +           FS++KLW FTGPGFLMSIA+LDPGN+E D+QSGA A Y +LW+L+WAT++GLL+Q L+AR+GV TG HLAE+C  +Y    R++LW M E+A+IG+D QEVIG+AIAI
Sbjct:   53 AYFSDEKVLIPDDDSTNV---------GFSFRKLWAFTGPGFLMSIAYLDPGNIESDMQSGAAAKYKILWVLLWATVLGLLMQRLAARLGVVTGLHLAEMCYRQYKRLPRWILWIMIEIAIIGSDMQEVIGTAIAI 179          
BLAST of CV884662 vs. ExPASy Swiss-Prot
Match: NRAM2_RAT (Natural resistance-associated macrophage protein 2 OS=Rattus norvegicus GN=Slc11a2 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 5.216e-40
Identity = 92/183 (50.27%), Postives = 119/183 (65.03%), Query Frame = 2
Query:   98 MDSSETREEESGSKDSNETNRLLPI------PSPPSSTEDDEE---VAFDSREKILIVDADSASTLNVDGDQVPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLMWATLMGLLIQLLSARVGVATGRHLAELCREEYPNWARFVLWFMAEVALIGADFQEVIGSAIAI 619
            +D  E   ++  S D  ++  L  I       S P ST D EE     FD  EKI I + + +            FS++KLW FTGPGFLMSIA+LDPGN+E DLQSGA+AG+ LLW+L+ AT++GLL+Q L+AR+GV TG HLAE+C  +YP   R +LW M E+A+IG+D QEVIGSAIAI
Sbjct:    3 LDPEEKIPDDGASGDHGDSASLGAINPAYSNSSLPHSTGDSEEPFTTYFD--EKIPIPEEEYSC-----------FSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWVLLLATIVGLLLQRLAARLGVVTGLHLAEVCHRQYPKVPRIILWLMVELAIIGSDMQEVIGSAIAI 172          
BLAST of CV884662 vs. ExPASy Swiss-Prot
Match: NRAM2_HUMAN (Natural resistance-associated macrophage protein 2 OS=Homo sapiens GN=SLC11A2 PE=1 SV=2)

HSP 1 Score: 164.081 bits (414), Expect = 5.216e-40
Identity = 89/176 (50.57%), Postives = 111/176 (63.07%), Query Frame = 2
Query:   95 KMDSSETREEESGSKDSNETNRLLPIPSPPSSTEDDEEV-AFDSREKILIVDADSASTLNVDGDQVPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLMWATLMGLLIQLLSARVGVATGRHLAELCREEYPNWARFVLWFMAEVALIGADFQEVIGSAIAI 619
            KM       +   S      N     PS   S  D EE  A    EKI I + + +            FS++KLW FTGPGFLMSIA+LDPGN+E DLQSGA+AG+ LLW+L+ ATL+GLL+Q L+AR+GV TG HLAE+C  +YP   R +LW M E+A+IG+D QEVIGSAIAI
Sbjct:    8 KMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSC-----------FSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWILLLATLVGLLLQRLAARLGVVTGLHLAEVCHRQYPKVPRVILWLMVELAIIGSDMQEVIGSAIAI 172          
BLAST of CV884662 vs. ExPASy Swiss-Prot
Match: NRAM1_DICDI (Metal transporter nramp1 homolog OS=Dictyostelium discoideum GN=nramp1 PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.191e-38
Identity = 70/117 (59.83%), Postives = 94/117 (80.34%), Query Frame = 2
Query:  269 NVDGDQVPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLMWATLMGLLIQLLSARVGVATGRHLAELCREEYPNWARFVLWFMAEVALIGADFQEVIGSAIAI 619
            N+D       ++K LW FTGPGFLMSIA+LDPGNLE D+Q+GA+AGY LLW+L W+T++G  +Q+L++R+GV TG+HLAE CRE+YP   R +LW M E+A+IG+D QEVIG+AIA+
Sbjct:   60 NIDKPDSKWINFKTLWAFTGPGFLMSIAYLDPGNLESDIQAGAMAGYQLLWVLFWSTVIGFWLQMLASRLGVVTGKHLAEHCREQYPKTPRLLLWLMTELAIIGSDIQEVIGTAIAL 176          
BLAST of CV884662 vs. ExPASy Swiss-Prot
Match: NRAM1_CHICK (Natural resistance-associated macrophage protein 1 OS=Gallus gallus GN=SLC11A1 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.164e-37
Identity = 70/117 (59.83%), Postives = 92/117 (78.63%), Query Frame = 2
Query:  266 LNVDGDQVPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLMWATLMGLLIQLLSARVGVATGRHLAELCREEYPNWARFVLWFMAEVALIGADFQEVIGSAIA 616
            +++     P FS++KLW FTGPGFLMSIA+LDPGN+E DLQ GA+AG+ LLW+L+WAT++GLL Q L+ R+GV TG+ LAE+C   YP   R +LW M E+A+IG+D QEVIG+AIA
Sbjct:   48 ISIPKGSTPGFSFRKLWAFTGPGFLMSIAYLDPGNVESDLQCGAVAGFKLLWVLLWATVLGLLCQRLAIRLGVVTGKDLAEICYLYYPRVPRVLLWLMMEIAIIGSDMQEVIGTAIA 164          
The following BLAST results are available for this feature:
BLAST of CV884662 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 139
Match NameE-valueIdentityDescription
NRAM2_ARATH8.835e-6477.02Metal transporter Nramp2 OS=Arabidopsis thaliana G... [more]
NRAM3_ARATH1.236e-5775.69Metal transporter Nramp3 OS=Arabidopsis thaliana G... [more]
NRAM5_ARATH2.108e-5766.09Metal transporter Nramp5 OS=Arabidopsis thaliana G... [more]
NRAM4_ARATH3.595e-5770.63Metal transporter Nramp4 OS=Arabidopsis thaliana G... [more]
NRAM2_MOUSE3.058e-4050.27Natural resistance-associated macrophage protein 2... [more]
MVL_DROME3.994e-4058.09Protein Malvolio OS=Drosophila melanogaster GN=Mvl... [more]
NRAM2_RAT5.216e-4050.27Natural resistance-associated macrophage protein 2... [more]
NRAM2_HUMAN5.216e-4050.57Natural resistance-associated macrophage protein 2... [more]
NRAM1_DICDI2.191e-3859.83Metal transporter nramp1 homolog OS=Dictyostelium ... [more]
NRAM1_CHICK3.164e-3759.83Natural resistance-associated macrophage protein 1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS04_2_008G10_T3 Ruby Orange Developing Flower cDNA Library UCRCS04-UCR Citrus sinensis cDNA clone UCRCS04_008_T3_G10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV884662 ID=CV884662|Name=CV884662|organism=Citrus sinensis|type=EST|length=619bp
GACCGTTTTCACCAGTCCTCAGAGGTGAGATCTGTGGAACAGAATCTACT
GCCGAGTTTGGAATATTCCGTGCGTAGATAAAACAAAGAAAGTGAAAATG
GACTCCTCCGAAACCCGAGAAGAAGAAAGCGGGTCCAAAGACAGCAATGA
AACCAACCGCCTCCTTCCAATACCGTCACCACCGTCCTCAACGGAGGACG
ACGAGGAAGTCGCGTTCGATTCACGAGAGAAAATCTTGATCGTCGACGCA
GATTCAGCCTCCACGTTGAACGTTGACGGTGACCAAGTGCCGCCTTTTTC
GTGGAAAAAGCTTTGGTTATTCACTGGACCCGGTTTCTTAATGAGCATAG
CGTTTCTGGATCCGGGGAATCTGGAGGGGGATCTCCAATCGGGGGCGATA
GCAGGGTACTCGCTTCTTTGGTTGCTAATGTGGGCCACCCTCATGGGCTT
GCTTATTCAGCTGCTGTCGGCACGAGTAGGGGTGGCCACGGGGCGTCACT
TGGCAGAGCTGTGTAGAGAGGAGTACCCCAATTGGGCGCGATTCGTGTTG
TGGTTCATGGCTGAAGTGGCCTTGATTGGTGCCGATTTTCAGGAAGTAAT
TGGGAGTGCCATTGCTATC
back to top