CV884656

Overview
NameCV884656
Unique NameCV884656
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length491
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Library UCRCS04-UCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig417 contig Csv1_Contig417:35..525. BLAST: Citrus Unigene V1 Contigs to Populus V2 proteins
Homology
BLAST of CV884656 vs. ExPASy Swiss-Prot
Match: TOM6_ARATH (Mitochondrial import receptor subunit TOM6 homolog OS=Arabidopsis thaliana GN=TOM6 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.895e-13
Identity = 32/42 (76.19%), Postives = 38/42 (90.48%), Query Frame = 2
Query:   62 MFPGMFMKKPDKAAALKQLRSHVAMFGTWVVVIRVTPYLLHY 187
            MFPGMFM+KPDKA ALKQLR+HVA+FG+WVV+IR  PY+L Y
Sbjct:    1 MFPGMFMRKPDKAEALKQLRTHVALFGSWVVIIRAAPYVLSY 42          
The following BLAST results are available for this feature:
BLAST of CV884656 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
TOM6_ARATH1.895e-1376.19Mitochondrial import receptor subunit TOM6 homolog... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS04_2_008G07_T3 Ruby Orange Developing Flower cDNA Library UCRCS04-UCR Citrus sinensis cDNA clone UCRCS04_008_T3_G07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV884656 ID=CV884656|Name=CV884656|organism=Citrus sinensis|type=EST|length=491bp
GACGTATTGAAGCGTCTGATCAACAGAGTAACACAAAGCTAGGGTTTAAG
CCGAAGCAAGGATGTTTCCGGGAATGTTCATGAAGAAGCCAGACAAGGCG
GCGGCCTTGAAGCAGCTGCGGAGCCACGTGGCCATGTTCGGGACCTGGGT
CGTTGTGATTCGCGTCACCCCCTACCTTCTTCACTATTTCTCCAGAGAAA
AAGAAGAGCTCAAGCTCGAATTCTAACTCTCTCTTTCTCTCTCTAGCTGA
ACCGTCTTTTTCTCTGTGTTTGGTGGTGCGGCAGCTGTAAGATGAAGATG
AAGAGAAAGTGGCGCGCTGTTTAGAAGTGTCATAATTGTTTTTAATGTAT
GCCCTGGATTTGGCAGGGGTAACATACCTGTAACTTGTTATTGAGTTTGA
AGCGTGGGTGGGTACTTTCGTAAAATGCAATAACTGGTCTATGATTATTC
TTGTTGAATTTACTTTTGGTAGTAGTATCTACTAATTAATT
back to top