CV884650

Overview
NameCV884650
Unique NameCV884650
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length897
Libraries
Library NameType
Ruby Orange Developing Flower cDNA Library UCRCS04-UCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CV884650 vs. ExPASy Swiss-Prot
Match: VA726_ARATH (Putative vesicle-associated membrane protein 726 OS=Arabidopsis thaliana GN=VAMP726 PE=2 SV=2)

HSP 1 Score: 371.703 bits (953), Expect = 3.153e-102
Identity = 181/219 (82.65%), Postives = 194/219 (88.58%), Query Frame = -1
Query:  208 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXLSVCHGFKC 864
            MGQQSLIYSFVARGTVILAEYTEF GNFTS+A+QCLQKLP++NNKFTYNCDGHTFNYL +NGFTYCVV +ESAGRQIP+AFLERVKEDFNKRYGGGKA+TA ANSLNKEFGSKLKEHMQYC DHPEEISKL+KVKAQV+EVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFR QGTKM+RK+W +NM                  LSVCHGFKC
Sbjct:    1 MGQQSLIYSFVARGTVILAEYTEFKGNFTSVAAQCLQKLPSSNNKFTYNCDGHTFNYLADNGFTYCVVVIESAGRQIPMAFLERVKEDFNKRYGGGKASTAKANSLNKEFGSKLKEHMQYCADHPEEISKLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMKRKLWFENMKIKLIVFGIIVALILIIILSVCHGFKC 219          
BLAST of CV884650 vs. ExPASy Swiss-Prot
Match: VA721_ARATH (Vesicle-associated membrane protein 721 OS=Arabidopsis thaliana GN=VAMP721 PE=2 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 2.044e-101
Identity = 182/219 (83.11%), Postives = 195/219 (89.04%), Query Frame = -1
Query:  208 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXLSVCHGFKC 864
            M QQSLIYSFVARGTVIL E+T+F GNFTSIA+QCLQKLP++NNKFTYNCDGHTFNYLVE+GFTYCVVAV+SAGRQIP++FLERVKEDFNKRYGGGKAATA ANSLNKEFGSKLKEHMQYC+DHP+EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFR  GT+MRRKMW+QNM                  LSVCHGFKC
Sbjct:    1 MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVEDGFTYCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC 219          
BLAST of CV884650 vs. ExPASy Swiss-Prot
Match: VA725_ARATH (Vesicle-associated membrane protein 725 OS=Arabidopsis thaliana GN=VAMP725 PE=2 SV=2)

HSP 1 Score: 368.622 bits (945), Expect = 2.669e-101
Identity = 184/225 (81.78%), Postives = 197/225 (87.56%), Query Frame = -1
Query:  208 VRVLR-MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXLSVCHGFKC 879
            +RV R MGQQ+LIYSFVARGTVIL EYTEF GNFT++A+QCLQKLP++NNKFTYNCDGHTFNYLVENGFTYCVVAVES GRQIP+AFLERVKEDFNKRYGGGKA TA ANSLN+EFGSKLKEHMQYCVDHP+EISKLAKVKAQV+EVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFR QGTK+RRKMW +NM                  LSVC GFKC
Sbjct:   60 LRVTRTMGQQNLIYSFVARGTVILVEYTEFKGNFTAVAAQCLQKLPSSNNKFTYNCDGHTFNYLVENGFTYCVVAVESVGRQIPMAFLERVKEDFNKRYGGGKATTAQANSLNREFGSKLKEHMQYCVDHPDEISKLAKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKIRRKMWFENMKIKLIVLGIIITLILIIILSVCGGFKC 284          
BLAST of CV884650 vs. ExPASy Swiss-Prot
Match: VA722_ARATH (Vesicle-associated membrane protein 722 OS=Arabidopsis thaliana GN=VAMP722 PE=2 SV=2)

HSP 1 Score: 367.466 bits (942), Expect = 5.946e-101
Identity = 182/219 (83.11%), Postives = 193/219 (88.13%), Query Frame = -1
Query:  208 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXLSVCHGFKC 864
            M QQSLIYSFVARGTVIL E+T+F GNFTSIA+QCLQKLP++NNKFTYNCDGHTFNYLVENGFTYCVVAV+SAGRQIP+AFLERVKEDFNKRYGGGKAATA ANSLNKEFGSKLKEHMQYC+DHP+EISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFR QGT+MRRKMW QNM                  LS+C GF C
Sbjct:    1 MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENGFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRKMWFQNMKIKLIVLAIIIALILIIILSICGGFNC 219          
BLAST of CV884650 vs. ExPASy Swiss-Prot
Match: VA724_ARATH (Vesicle-associated membrane protein 724 OS=Arabidopsis thaliana GN=VAMP724 PE=2 SV=2)

HSP 1 Score: 305.834 bits (782), Expect = 2.125e-82
Identity = 148/220 (67.27%), Postives = 176/220 (80.00%), Query Frame = -1
Query:  208 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNN-KFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXLSVCHGFKC 864
            MGQ+S IYSFVARGT+ILAEYTEFTGNF SIA+QCLQKLP+++N KFTYNCD HTFN+LVE+G+ YCVVA +S  +QI IAFLERVK DF KRYGGGKA+TA+A SLNKEFG  +KEHM Y VDH EEI KL KVKAQVSEVK +M+ENI+K +DRGE + +L DKTENLRSQAQ++++QGT++RRK+W QNM                  +SVCHGF C
Sbjct:    1 MGQESFIYSFVARGTMILAEYTEFTGNFPSIAAQCLQKLPSSSNSKFTYNCDHHTFNFLVEDGYAYCVVAKDSLSKQISIAFLERVKADFKKRYGGGKASTAIAKSLNKEFGPVMKEHMNYIVDHAEEIEKLIKVKAQVSEVKSIMLENIDKAIDRGENLTVLTDKTENLRSQAQEYKKQGTQVRRKLWYQNMKIKLVVLGILLLLVLIIWISVCHGFNC 220          
BLAST of CV884650 vs. ExPASy Swiss-Prot
Match: VA723_ARATH (Vesicle-associated membrane protein 723 OS=Arabidopsis thaliana GN=VAMP723 PE=2 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 2.972e-76
Identity = 147/219 (67.12%), Postives = 166/219 (75.80%), Query Frame = -1
Query:  208 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXLSVCHGFKC 864
            M QQSL YSF+ARGTVIL E+T+F GNFTS+A+Q L+ LP++NNKFTYNCDGHTFN LVENGFTYCVVAV+SAGR+IP+AFLERVKEDF KRYGG KAAT  ANSLNKEFGS LKEHMQYC+DHP+EIS LAK KAQVSEVK +MMENIEKVL RG   E+L     +  SQ Q F  + T+M+RK W QNM                  LSVC GF C
Sbjct:    1 MAQQSLFYSFIARGTVILVEFTDFKGNFTSVAAQYLENLPSSNNKFTYNCDGHTFNDLVENGFTYCVVAVDSAGREIPMAFLERVKEDFYKRYGGEKAATDQANSLNKEFGSNLKEHMQYCMDHPDEISNLAKAKAQVSEVKSLMMENIEKVLARGVICEML----GSSESQPQAFYIKRTQMKRKKWFQNMKIKLIVLAIIIALILIIILSVCGGFNC 215          
BLAST of CV884650 vs. ExPASy Swiss-Prot
Match: VA727_ARATH (Vesicle-associated membrane protein 727 OS=Arabidopsis thaliana GN=VAMP727 PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 8.375e-71
Identity = 132/238 (55.46%), Postives = 169/238 (71.01%), Query Frame = -1
Query:  208 MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGG-------------------KAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXLSVCHGFKC 864
            M Q+ LIYSFVA+GTV+LAE+T ++GNF++IA QCLQKLP  ++K+TY+CDGHTFN+LV+NGF + VVA ES GR +P  FLERVKEDF KRY                          +VA +L++EFG  LKEHMQYC+ HPEE+SKL+K+KAQ++EVKG+MM+NIEKVLDRGEKIELLVDKTENL+ QA  F++QG ++RRKMW+Q++                  +  C GFKC
Sbjct:    1 MSQKGLIYSFVAKGTVVLAEHTPYSGNFSTIAVQCLQKLPTNSSKYTYSCDGHTFNFLVDNGFVFLVVADESTGRSVPFVFLERVKEDFKKRYEASIKNDERHPLADEDEDDDLFGDRFSVAYNLDREFGPILKEHMQYCMSHPEEMSKLSKLKAQITEVKGIMMDNIEKVLDRGEKIELLVDKTENLQFQADSFQRQGRQLRRKMWLQSLQMKLMVAGAVFSFILIVWVVACGGFKC 238          
BLAST of CV884650 vs. ExPASy Swiss-Prot
Match: VA711_ARATH (Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana GN=VAMP711 PE=2 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 9.671e-35
Identity = 78/213 (36.62%), Postives = 129/213 (60.56%), Query Frame = -1
Query:  217 SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNK-FTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXLSVCHG 852
            +++Y+ VARGTV+L+E+T  + N ++IA Q L+K+P  N+   +Y+ D + F+    +G T   +A E+AGR+IP AFLE + + F + YG     TA+A ++N+EF   L + + Y  + P    ++ ++K ++++V+GVM+ENI+KVLDRGE++ELLVDKT N++     FR+Q  + R  +W +N                     +CHG
Sbjct:    2 AILYALVARGTVVLSEFTATSTNASTIAKQILEKVPGDNDSNVSYSQDRYVFHVKRTDGLTVLCMAEETAGRRIPFAFLEDIHQRFVRTYGRA-VHTALAYAMNEEFSRVLSQQIDYYSNDPNA-DRINRIKGEMNQVRGVMIENIDKVLDRGERLELLVDKTANMQGNTFRFRKQARRFRSNVWWRNCKLTVLLILLLLVIIYIAVAFLCHG 212          
BLAST of CV884650 vs. ExPASy Swiss-Prot
Match: VA713_ARATH (Vesicle-associated membrane protein 713 OS=Arabidopsis thaliana GN=VAMP713 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.814e-34
Identity = 80/214 (37.38%), Postives = 130/214 (60.75%), Query Frame = -1
Query:  217 SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPA--TNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQNMXXXXXXXXXXXXXXXXXXLSVCHG 852
            ++I++ VARGTV+L+E++  + N +SI+ Q L+KLP   +++  +Y+ D + F+    +G T   +A E+AGR IP AFL+ + + F K YG     +A A S+N EF   L + M++  + P    +++++K ++S+V+ VM+ENI+KVLDRGE++ELLVDKTEN++     FR+Q  + R  MW +N+                    VCHG
Sbjct:    2 AIIFALVARGTVVLSEFSATSTNASSISKQILEKLPGNDSDSHMSYSQDRYIFHVKRTDGLTVLCMADETAGRNIPFAFLDDIHQRFVKTYGRA-IHSAQAYSMNDEFSRVLSQQMEFYSNDPNA-DRMSRIKGEMSQVRNVMIENIDKVLDRGERLELLVDKTENMQGNTFRFRKQARRYRTIMWWRNVKLTIALILVLALVVYIAMAFVCHG 213          
BLAST of CV884650 vs. ExPASy Swiss-Prot
Match: VA714_ARATH (Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana GN=VAMP714 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.634e-32
Identity = 69/189 (36.51%), Postives = 124/189 (65.61%), Query Frame = -1
Query:  292 SLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPA--TNNKFTYNCDGHTFNYLVENGFTYCVVAVESAGRQIPIAFLERVKEDFNKRYGGGKAATAVANSLNKEFGSKLKEHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQQGTKMRRKMWIQN 852
            +++Y+ VARGTV+LAE++  TGN  ++  + L+KL    ++ +  ++ D + F+ L  +G T+  +A ++ GR++P ++LE +   F K YG   A  A A ++N EF   L + M++   +P  +  L +V+ +VSE++ VM+ENIEK+++RG++IELLVDKT  ++  +  FR+Q  ++RR +W++N
Sbjct:    2 AIVYAVVARGTVVLAEFSAVTGNTGAVVRRILEKLSPEISDERLCFSQDRYIFHILRSDGLTFLCMANDTFGRRVPFSYLEEIHMRFMKNYGK-VAHNAPAYAMNDEFSRVLHQQMEFFSSNPS-VDTLNRVRGEVSEIRSVMVENIEKIMERGDRIELLVDKTATMQDSSFHFRKQSKRLRRALWMKN 188          
The following BLAST results are available for this feature:
BLAST of CV884650 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
VA726_ARATH3.153e-10282.65Putative vesicle-associated membrane protein 726 O... [more]
VA721_ARATH2.044e-10183.11Vesicle-associated membrane protein 721 OS=Arabido... [more]
VA725_ARATH2.669e-10181.78Vesicle-associated membrane protein 725 OS=Arabido... [more]
VA722_ARATH5.946e-10183.11Vesicle-associated membrane protein 722 OS=Arabido... [more]
VA724_ARATH2.125e-8267.27Vesicle-associated membrane protein 724 OS=Arabido... [more]
VA723_ARATH2.972e-7667.12Vesicle-associated membrane protein 723 OS=Arabido... [more]
VA727_ARATH8.375e-7155.46Vesicle-associated membrane protein 727 OS=Arabido... [more]
VA711_ARATH9.671e-3536.62Vesicle-associated membrane protein 711 OS=Arabido... [more]
VA713_ARATH2.814e-3437.38Vesicle-associated membrane protein 713 OS=Arabido... [more]
VA714_ARATH2.634e-3236.51Vesicle-associated membrane protein 714 OS=Arabido... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS04_2_008G03_T7 Ruby Orange Developing Flower cDNA Library UCRCS04-UCR Citrus sinensis cDNA clone UCRCS04_008_T7_G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV884650 ID=CV884650|Name=CV884650|organism=Citrus sinensis|type=EST|length=897bp
CCTATACAAGCAATCGAAAAGATACAAATTCATTCCCTTGCCAAGGGGCA
AGTAAGGGCATGATGACCTAAAAGAGGGGAAAAAGAAAACATAAACAAAA
ACAAGCGTGAGAGATGCAAGGATCAAAAGATGTGGCCAATGTACCAAGTC
GACCATGTCAGCGGGACAGCAAAGCACAGTTTCCAGGGACTTTCCAAGAC
CAAATCAACATTTGAAGCCATGGCAAACTGACAGAACGATGATAAGGATC
AATGCGATGATGATACCCAAAACGATCAATTTAATCTTCATATTCTGGAT
CCACATCTTCCTTCTCATCTTCGTCCCCTGTTGTCGGAAATCTTGTGCCT
GTGACCGAAGGTTCTCAGTTTTGTCAACCAGCAGCTCAATCTTCTCACCA
CGATCAAGAACCTTCTCAATATTTTCCATCATAACCCCCTTGACTTCAGA
AACCTGAGCTTTGACTTTGGCAAGCTTGCTGATCTCTTCAGGATGATCCA
CACAATACTGCATGTGCTCCTTTAGTTTAGACCCAAACTCTTTGTTCAGG
CTATTTGCAACAGCCGTTGCAGCTTTTCCTCCACCATATCTCTTGTTGAA
ATCCTCCTTAACTCGCTCCAGAAAGGCAATTGGAATTTGCCTGCCAGCAG
ATTCAACAGCAACCACACAATAGGTGAAGCCGTTCTCAACGAGGTAATTG
AAGGTGTGGCCATCGCAGTTGTAGGTGAACTTGTTATTGGTAGCGGGAAG
TTTCTGGAGACATTGCGATGCGATGCTCGTGAAATTACCGGTGAACTCAG
TGTACTCGGCGAGGATCACCGTGCCTCGAGCCACGAAGCTATAGATCAAC
GACTGTTGGCCCATCCTCAAAACCCTAACCCTAGATTCAAATTCGAG
back to top