EY665198

Overview
NameEY665198
Unique NameEY665198
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1006
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER42_ARATH (Peroxidase 42 OS=Arabidopsis thaliana GN=PER42 PE=1 SV=2)

HSP 1 Score: 317.775 bits (813), Expect = 6.409e-86
Identity = 165/242 (68.18%), Postives = 192/242 (79.34%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHLTPEQEEKTLLLKKWAKIQELTSLREFSRTISPPF*KKPLSQGKKG 727
            ASLLLDSTR+ L EKE DRSFG+RNFRYIE IKEA+ERECPGVVSC+DILVLS R+G+ A+GGPYIPLKTGRRDG KSR ++LE YLPDHN+S+SVVLE+F +IGID PGLVALLGSHSVGRTHCVKLVHRLYPEVDP+LNPDHVPHML  CP+ IPDPKAVQYVRNDRGTP+VL+ +         KGL+ VD  L  ++  +  ++KK AK Q     +EF+R I       PL+ G KG
Sbjct:   80 ASLLLDSTRRELGEKEHDRSFGLRNFRYIEEIKEALERECPGVVSCSDILVLSAREGIEAVGGPYIPLKTGRRDGLKSRTDMLESYLPDHNESISVVLEKFKSIGIDTPGLVALLGSHSVGRTHCVKLVHRLYPEVDPSLNPDHVPHMLHKCPDSIPDPKAVQYVRNDRGTPMVLDNNYY-RNILDNKGLLLVDHQLAHDKRTRP-IVKKMAKDQAY-FFKEFTRAIQILSENNPLT-GSKG 317          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER21_ARATH (Peroxidase 21 OS=Arabidopsis thaliana GN=PER21 PE=1 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 3.550e-52
Identity = 106/210 (50.48%), Postives = 140/210 (66.67%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPL-KTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHLTPEQEEKTLLLK 628
            ASLLL++ R   SE++  RSFGMRNF+Y++ IK+A+E+ECP  VSCADI+ LS RDG+V L GP I + KTGRRD R S    +E  +P+HNDS+S V+  F +IGID    VALLG+HSVGR HCV LVHRLYP +DP L+P +  ++   CP   PDP AV Y RNDR TP+V++ ++        KGL+ +D  L  +      + K
Sbjct:   79 ASLLLETARGVESEQKSKRSFGMRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKGPKIEMIKTGRRDSRGSYLGDVETLIPNHNDSLSSVISTFNSIGIDVEATVALLGAHSVGRVHCVNLVHRLYPTIDPTLDPSYALYLKKRCPSPTPDPNAVLYSRNDRETPMVVD-NMYYKNIMAHKGLLVIDDELATDPRTAPFVAK 287          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER48_ARATH (Putative Peroxidase 48 OS=Arabidopsis thaliana GN=PER48 PE=2 SV=3)

HSP 1 Score: 124.79 bits (312), Expect = 7.963e-28
Identity = 63/158 (39.87%), Postives = 95/158 (60.13%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CP 460
            AS+LLD+     SEK+   +  ++ F  I+ +K  +E  CPGVVSCAD+LVL+ R+ V+  GGP+ PL+TGR+D   +  +  E  LP  + ++SV+L+RF+  G +    V+L G+HS+G THC    +RLY      + DP LNP  +  +   CP
Sbjct:  117 ASVLLDADEAHTSEKDASPNLSLKGFDVIDAVKSELENVCPGVVSCADLLVLAAREAVLVAGGPFYPLETGRKDSAAAYRDFAEHELPAPDATLSVILQRFSFRGFNERETVSLFGAHSIGITHCTFFKNRLYNFSATGKPDPELNPGFLQELKTKCP 274          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER64_ARATH (Peroxidase 64 OS=Arabidopsis thaliana GN=PER64 PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 9.111e-24
Identity = 64/157 (40.76%), Postives = 89/157 (56.69%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CP 460
            S+LLDS  K  +EK+   +  +  F  I+N K+A+E +CPG+VSCADIL L+ RD V   GGP   +  GR+DGR S+A I  + LP    ++S + + F   G+    LVAL G H++G  HC    +RL+      EVDP LNP     +   CP
Sbjct:   73 SVLLDSKGKNKAEKDGPPNISLHAFYVIDNAKKALEEQCPGIVSCADILSLAARDAVALSGGPTWAVPKGRKDGRISKA-IETRQLPAPTFNISQLRQNFGQRGLSMHDLVALSGGHTLGFAHCSSFQNRLHKFNTQKEVDPTLNPSFAARLEGVCP 228          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER52_ARATH (Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 9.111e-24
Identity = 57/137 (41.61%), Postives = 80/137 (58.39%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEM-DRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVD 412
            S+LLD T     E+         R F  I+NIK AVE+ CPGVVSCADIL ++ RD VVALGGP   +K GRRD R +        +P    S+S ++  F+A+G+    +VAL G+H++G++ C     R+Y E +
Sbjct:   80 SILLDDTSSFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVKVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRARIYNETN 216          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER2_ARAHY (Cationic peroxidase 2 OS=Arachis hypogaea GN=PNC2 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.007e-22
Identity = 59/147 (40.14%), Postives = 87/147 (59.18%), Query Frame = 2
Query:   38 SEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPE 463
            +EK    + G+R +  I++ K  +E  CPGVVSCADIL L+ RD VV  GG    + TGRRDGR S+A  +   LP  +DS+ V  ++FAA G++   LV L+G H++G + C    +RL+        DPA++P  V ++   CP+
Sbjct:   90 TEKTAFANLGLRGYEIIDDAKTQLEAACPGVVSCADILALAARDSVVLSGGLSWQVPTGRRDGRVSQASDVSN-LPAPSDSVDVQKQKFAAKGLNTQDLVTLVGGHTIGTSECQFFSNRLFNFNGTAAADPAIDPSFVSNLQALCPQ 235          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER66_ARATH (Peroxidase 66 OS=Arabidopsis thaliana GN=PER66 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 2.244e-22
Identity = 58/158 (36.71%), Postives = 89/158 (56.33%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRL-----YPEVDPALNPDHVPHMLP*CP 460
            AS+LLDSTR   +EK+   +  +R+F  IE+ K  +E+ CP  VSCAD++ ++ RD V   GGPY  +  GR+DG  SRA      LP    ++S +++ FAA G+    +V L G H++G +HC     RL     + ++DP++N      +   CP
Sbjct:   75 ASILLDSTRSNQAEKDGPPNISVRSFYVIEDAKRKLEKACPRTVSCADVIAIAARDVVTLSGGPYWSVLKGRKDGTISRANETRN-LPPPTFNVSQLIQSFAARGLSVKDMVTLSGGHTIGFSHCSSFESRLQNFSKFHDIDPSMNYAFAQTLKKKCP 231          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER72_ARATH (Peroxidase 72 OS=Arabidopsis thaliana GN=PER72 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.931e-22
Identity = 74/222 (33.33%), Postives = 107/222 (48.20%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGM-RNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPE-----VDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHLTPEQEEKTLLLKKWAKIQE 649
            AS+LLDS+   +SEK  + +    R F  IE IK A+E+ECP  VSCADIL L+ RD  V  GGP   +  GRRD R +        +P  N++   +L +F   G+D   LV+L GSH++G + C     RLY +      D  L+  +   +   CP    D         D  TP   + H         KGL+  D  L  + ++   L++ +A+ QE
Sbjct:   82 ASILLDSSGTIISEKRSNPNRNSARGFELIEEIKHALEQECPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTILTKFKRQGLDLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDMTLSQYYATLLRQRCPRSGGDQTLFFL---DFATPFKFDNHYF-KNLIMYKGLLSSDEILFTKNKQSKELVELYAENQE 299          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER56_ARATH (Peroxidase 56 OS=Arabidopsis thaliana GN=PER56 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.931e-22
Identity = 69/213 (32.39%), Postives = 111/213 (52.11%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHLTPEQEEKTLLLK 628
            S+LL+   K   EK    +  +R F  I+N+K A+E+ECPG+VSC+D+L L  RD +VAL GP   ++TGRRDG  +        LP   +++S ++ +F + G+D   LV L G H++G  HC ++ +RLY      + DP L+ ++   +     +C P       +  D G+    ++          +GL + D  L   QE K+ +LK
Sbjct:   82 SVLLELKNKK-DEKNSIPNLTLRGFEIIDNVKAALEKECPGIVSCSDVLALVARDAMVALNGPSWEVETGRRDGLVTNITEALLNLPSPFNNISSLITQFQSKGLDKKDLVVLSGGHTIGNGHCPQITNRLYNFTGKGDSDPNLDTEYAVKLR---GKCKPTDTTTA-LEMDPGSFKTFDESYF-KLVSQRRGLFQSDAALLDNQETKSYVLK 288          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER17_ARATH (Peroxidase 17 OS=Arabidopsis thaliana GN=PER17 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.931e-22
Identity = 56/159 (35.22%), Postives = 88/159 (55.35%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEK-EMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPE-----VDPALNPDHVPHMLP*CP 460
            ASLLLD T   L EK  +     +R+F  +++IKEA+E+ CP  VSCADI++++ RD V   GGP   +K GR+D   +  +  +  +P    + + +++ F    +    +VAL GSHS+G+  C  ++ RLY +      DPAL P +   +   CP
Sbjct:   72 ASLLLDDTPNMLGEKLSLSNIDSLRSFEVVDDIKEALEKACPATVSCADIVIMAARDAVALTGGPDWEVKLGRKDSLTASQQDSDDIMPSPRANATFLIDLFERFNLSVKDMVALSGSHSIGQGRCFSIMFRLYNQSGSGKPDPALEPSYRKKLDKLCP 230          
The following BLAST results are available for this feature:
BLAST of EY665198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 104
Match NameE-valueIdentityDescription
PER42_ARATH6.409e-8668.18Peroxidase 42 OS=Arabidopsis thaliana GN=PER42 PE=... [more]
PER21_ARATH3.550e-5250.48Peroxidase 21 OS=Arabidopsis thaliana GN=PER21 PE=... [more]
PER48_ARATH7.963e-2839.87Putative Peroxidase 48 OS=Arabidopsis thaliana GN=... [more]
PER64_ARATH9.111e-2440.76Peroxidase 64 OS=Arabidopsis thaliana GN=PER64 PE=... [more]
PER52_ARATH9.111e-2441.61Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=... [more]
PER2_ARAHY1.007e-2240.14Cationic peroxidase 2 OS=Arachis hypogaea GN=PNC2 ... [more]
PER66_ARATH2.244e-2236.71Peroxidase 66 OS=Arabidopsis thaliana GN=PER66 PE=... [more]
PER72_ARATH2.931e-2233.33Peroxidase 72 OS=Arabidopsis thaliana GN=PER72 PE=... [more]
PER56_ARATH2.931e-2232.39Peroxidase 56 OS=Arabidopsis thaliana GN=PER56 PE=... [more]
PER17_ARATH2.931e-2235.22Peroxidase 17 OS=Arabidopsis thaliana GN=PER17 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-B07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665198 ID=EY665198|Name=EY665198|organism=Citrus sinensis|type=EST|length=1006bp
TGCTTCACTGCTTCTGGACTCGACTAGAAAGACCTTGTCTGAGAAGGAGA
TGGACAGGAGCTTTGGTATGAGGAACTTCAGGTACATTGAGAACATCAAA
GAAGCTGTTGAAAGAGAGTGCCCTGGTGTTGTTTCCTGTGCTGATATTCT
TGTCCTGTCCGGTAGAGATGGCGTTGTTGCGCTTGGAGGCCCTTACATTC
CTCTCAAGACAGGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTT
GAGCAGTATCTCCCAGATCACAACGACAGCATGTCTGTTGTTCTTGAGAG
GTTTGCAGCCATTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGAT
CTCACAGTGTTGGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTAC
CCAGAAGTTGACCCTGCACTGAACCCTGACCATGTTCCGCATATGCTCCC
ATAATGTCCTGAATGCATCCCAGACCCCAAGGCTGTTCAGTATGTGAGGA
ATGACCGTGGCACCCCCCTGGTGCTGGAACAACACCTACTATAGGGAACT
TATTGGACAACAAAGGGCTTGATTGAGGTTGATCTTCACCTAACCCCCGA
ACAAGAGGAAAAGACCTTATTGTTAAAAAAATGGGCCAAAATCCAAGAAT
TAACTTCCTTAAGGGAATTTTCAAGAACCATTTCCCCTCCTTTTTGAAAA
AAACCCCTCTCCCAAGGTAAAAAGGGGGGAAATCCCAAAGGGTTGGGAAT
TTTTGCCCCAAAAAACCCCCCCAAAAAAATCCCAAAGTTATCTAAAAACA
CTTGTTTTTTTACTCCACAACAAAATTTAAATAACCCCCCCAATTTTTTC
TTTTCCCTTTGTTTTTTTTTCTCATAAAGAGAAAAAAAAAAAAAAAAGGG
GGGGGGAAATAAGCCCCCCTCCCCAAAAAAAAAAAAGGGGTTTTTTTTCT
TAAAAAAAATAAGGGTTGTTTTTGTTTCTCCCCCTCGCGGGGGAAAAGAG
AAGAGT
back to top