EY665192

Overview
NameEY665192
Unique NameEY665192
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length911
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665192 vs. ExPASy Swiss-Prot
Match: CRK25_ARATH (Cysteine-rich receptor-like protein kinase 25 OS=Arabidopsis thaliana GN=CRK25 PE=2 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 3.373e-59
Identity = 113/169 (66.86%), Postives = 139/169 (82.25%), Query Frame = 1
Query:    1 KRLSSHSRLGLEEFKNEMMLIAKLQHRHLVRLFGCCVEQGENILIYEYMPNKSLDVFLFNPKKKRLLGWQARVRIIEGIAQGLLYLHRYSRLRIIHRDLKASNILLDSDMNPKISYFGMARISGDDELQGNTKRIAGTYGYMSPEYAL*GLNSIKSKVFNFGVLMLETL 507
            KRLS  S  G EEFKNE+ ++AKLQHR+L +L G C++  E IL+YE++PNKSLD FLF+ +K+R+L WQ R +IIEGIA+G+LYLHR SRL IIHRDLKASNILLD+DM+PKIS FGMARI G D+ Q NTKRI GTYGYMSPEYA+ G  S+KS V++FGVL+LE +
Sbjct:  375 KRLSQGSTQGAEEFKNEVDVVAKLQHRNLAKLLGYCLDGEEKILVYEFVPNKSLDYFLFDNEKRRVLDWQRRYKIIEGIARGILYLHRDSRLTIIHRDLKASNILLDADMHPKISDFGMARIFGVDQTQANTKRIVGTYGYMSPEYAIHGKYSVKSDVYSFGVLVLELI 543          
BLAST of EY665192 vs. ExPASy Swiss-Prot
Match: CRK10_ARATH (Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana GN=CRK10 PE=1 SV=2)

HSP 1 Score: 220.705 bits (561), Expect = 9.186e-57
Identity = 110/169 (65.09%), Postives = 135/169 (79.88%), Query Frame = 1
Query:    1 KRLSSHSRLGLEEFKNEMMLIAKLQHRHLVRLFGCCVEQGENILIYEYMPNKSLDVFLFNPKKKRLLGWQARVRIIEGIAQGLLYLHRYSRLRIIHRDLKASNILLDSDMNPKISYFGMARISGDDELQGNTKRIAGTYGYMSPEYAL*GLNSIKSKVFNFGVLMLETL 507
            KRLS  S  G  EFKNE++L+AKLQHR+LVRL G C++  E +L+YEY+PNKSLD FLF+P KK  L W  R +II G+A+G+LYLH+ SRL IIHRDLKASNILLD+DMNPKI+ FGMARI G D+ + NT RI GTYGYMSPEYA+ G  S+KS V++FGVL+LE +
Sbjct:  365 KRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSLDYFLFDPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEII 533          
BLAST of EY665192 vs. ExPASy Swiss-Prot
Match: CRK35_ARATH (Putative cysteine-rich receptor-like protein kinase 35 OS=Arabidopsis thaliana GN=CRK35 PE=3 SV=2)

HSP 1 Score: 220.32 bits (560), Expect = 1.200e-56
Identity = 111/169 (65.68%), Postives = 136/169 (80.47%), Query Frame = 1
Query:    1 KRLSSHSRLGLEEFKNEMMLIAKLQHRHLVRLFGCCVEQGENILIYEYMPNKSLDVFLFNPKKKRLLGWQARVRIIEGIAQGLLYLHRYSRLRIIHRDLKASNILLDSDMNPKISYFGMARISGDDELQGNTKRIAGTYGYMSPEYAL*GLNSIKSKVFNFGVLMLETL 507
            KRLS  S  G EEFKNE +L++KLQH++LVRL G C+E  E IL+YE++PNKSLD FLF+P K+  L W  R  II GIA+G+LYLH+ SRL IIHRDLKASNILLD+DMNPKI+ FGMARI G D+ Q NT+RIAGT+GYMSPEYA+ G  S+KS V++FGVL+LE +
Sbjct:  373 KRLSKTSGQGAEEFKNEAVLVSKLQHKNLVRLLGFCLEGEEKILVYEFVPNKSLDYFLFDPAKQGELDWTRRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGVDQSQANTRRIAGTFGYMSPEYAMRGHFSMKSDVYSFGVLVLEII 541          
BLAST of EY665192 vs. ExPASy Swiss-Prot
Match: CRK15_ARATH (Cysteine-rich receptor-like protein kinase 15 OS=Arabidopsis thaliana GN=CRK15 PE=2 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 1.732e-55
Identity = 107/169 (63.31%), Postives = 134/169 (79.29%), Query Frame = 1
Query:    1 KRLSSHSRLGLEEFKNEMMLIAKLQHRHLVRLFGCCVEQGENILIYEYMPNKSLDVFLFNPKKKRLLGWQARVRIIEGIAQGLLYLHRYSRLRIIHRDLKASNILLDSDMNPKISYFGMARISGDDELQGNTKRIAGTYGYMSPEYAL*GLNSIKSKVFNFGVLMLETL 507
            KRLS  S  G  EFKNE++++AKLQHR+LVRL G  +  GE IL+YEYMPNKSLD FLF+P K+  L W  R ++I GIA+G+LYLH+ SRL IIHRDLKASNILLD+DMNPK++ FG+ARI G D+ Q NT RI GT+GYM+PEYA+ G  S+KS V++FGVL+LE +
Sbjct:  365 KRLSKSSGQGDTEFKNEVVVVAKLQHRNLVRLLGFSIGGGERILVYEYMPNKSLDYFLFDPAKQNQLDWTRRYKVIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKLADFGLARIFGMDQTQENTSRIVGTFGYMAPEYAIHGQFSVKSDVYSFGVLVLEII 533          
BLAST of EY665192 vs. ExPASy Swiss-Prot
Match: CRK11_ARATH (Cysteine-rich receptor-like protein kinase 11 OS=Arabidopsis thaliana GN=CRK11 PE=2 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 1.732e-55
Identity = 107/169 (63.31%), Postives = 135/169 (79.88%), Query Frame = 1
Query:    1 KRLSSHSRLGLEEFKNEMMLIAKLQHRHLVRLFGCCVEQGENILIYEYMPNKSLDVFLFNPKKKRLLGWQARVRIIEGIAQGLLYLHRYSRLRIIHRDLKASNILLDSDMNPKISYFGMARISGDDELQGNTKRIAGTYGYMSPEYAL*GLNSIKSKVFNFGVLMLETL 507
            KRLS  S  G  EF+NE +L+ KLQHR+LVRL G C+E+ E ILIYE++ NKSLD FLF+P+K+  L W  R +II GIA+G+LYLH+ SRL+IIHRDLKASNILLD+DMNPKI+ FG+A I G ++ QGNT RIAGTY YMSPEYA+ G  S+KS +++FGVL+LE +
Sbjct:  378 KRLSKKSGQGTREFRNEAVLVTKLQHRNLVRLLGFCLEREEQILIYEFVHNKSLDYFLFDPEKQSQLDWTRRYKIIGGIARGILYLHQDSRLKIIHRDLKASNILLDADMNPKIADFGLATIFGVEQTQGNTNRIAGTYAYMSPEYAMHGQYSMKSDIYSFGVLVLEII 546          
BLAST of EY665192 vs. ExPASy Swiss-Prot
Match: CRK12_ARATH (Putative cysteine-rich receptor-like protein kinase 12 OS=Arabidopsis thaliana GN=CRK12 PE=2 SV=2)

HSP 1 Score: 215.312 bits (547), Expect = 3.859e-55
Identity = 108/169 (63.91%), Postives = 133/169 (78.70%), Query Frame = 1
Query:    1 KRLSSHSRLGLEEFKNEMMLIAKLQHRHLVRLFGCCVEQGENILIYEYMPNKSLDVFLFNPKKKRLLGWQARVRIIEGIAQGLLYLHRYSRLRIIHRDLKASNILLDSDMNPKISYFGMARISGDDELQGNTKRIAGTYGYMSPEYAL*GLNSIKSKVFNFGVLMLETL 507
            KRLS  S  G +EFKNE++L+AKLQHR+LV+L G C+E  E IL+YE++PNKSLD FLF+P K+  L W  R  II GI +G+LYLH+ SRL IIHRDLKASNILLD+DM PKI+ FGMARISG D+   NTKRIAGT+GYM PEY + G  S+KS V++FGVL+LE +
Sbjct:  395 KRLSKTSEQGAQEFKNEVVLVAKLQHRNLVKLLGYCLEPEEKILVYEFVPNKSLDYFLFDPTKQGQLDWTKRYNIIGGITRGILYLHQDSRLTIIHRDLKASNILLDADMIPKIADFGMARISGIDQSVANTKRIAGTFGYMPPEYVIHGQFSMKSDVYSFGVLILEII 563          
BLAST of EY665192 vs. ExPASy Swiss-Prot
Match: CRK8_ARATH (Cysteine-rich receptor-like protein kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=2)

HSP 1 Score: 214.157 bits (544), Expect = 8.597e-55
Identity = 108/169 (63.91%), Postives = 133/169 (78.70%), Query Frame = 1
Query:    1 KRLSSHSRLGLEEFKNEMMLIAKLQHRHLVRLFGCCVEQGENILIYEYMPNKSLDVFLFNPKKKRLLGWQARVRIIEGIAQGLLYLHRYSRLRIIHRDLKASNILLDSDMNPKISYFGMARISGDDELQGNTKRIAGTYGYMSPEYAL*GLNSIKSKVFNFGVLMLETL 507
            KRLS +SR G  EFK E++++AKLQHR+LVRL G  ++  E IL+YEYMPNKSLD  LF+P K+  L W  R  II GIA+G+LYLH+ SRL IIHRDLKASNILLD+D+NPKI+ FGMARI G D+ Q NT RI GTYGYM+PEYA+ G  S+KS V++FGVL+LE +
Sbjct:  381 KRLSKNSRQGEAEFKTEVVVVAKLQHRNLVRLLGFSLQGEERILVYEYMPNKSLDCLLFDPTKQTQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKIADFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLVLEII 549          
BLAST of EY665192 vs. ExPASy Swiss-Prot
Match: CRK6_ARATH (Cysteine-rich receptor-like protein kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.467e-54
Identity = 108/169 (63.91%), Postives = 133/169 (78.70%), Query Frame = 1
Query:    1 KRLSSHSRLGLEEFKNEMMLIAKLQHRHLVRLFGCCVEQGENILIYEYMPNKSLDVFLFNPKKKRLLGWQARVRIIEGIAQGLLYLHRYSRLRIIHRDLKASNILLDSDMNPKISYFGMARISGDDELQGNTKRIAGTYGYMSPEYAL*GLNSIKSKVFNFGVLMLETL 507
            KRLS +SR G  EFK E++++AKLQHR+LVRL G  ++  E IL+YEYMPNKSLD  LF+P K+  L W  R  II GIA+G+LYLH+ SRL IIHRDLKASNILLD+D+NPKI+ FGMARI G D+ Q NT RI GTYGYM+PEYA+ G  S+KS V++FGVL+LE +
Sbjct:  379 KRLSKNSRQGEAEFKTEVVVVAKLQHRNLVRLLGFSLQGEERILVYEYMPNKSLDCLLFDPTKQIQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKIADFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLVLEII 547          
BLAST of EY665192 vs. ExPASy Swiss-Prot
Match: CRK20_ARATH (Putative cysteine-rich receptor-like protein kinase 20 OS=Arabidopsis thaliana GN=CRK20 PE=2 SV=2)

HSP 1 Score: 213.386 bits (542), Expect = 1.467e-54
Identity = 103/167 (61.68%), Postives = 135/167 (80.84%), Query Frame = 1
Query:    1 KRLSSHSRLGLEEFKNEMMLIAKLQHRHLVRLFGCCVEQGENILIYEYMPNKSLDVFLFNPKKKRLLGWQARVRIIEGIAQGLLYLHRYSRLRIIHRDLKASNILLDSDMNPKISYFGMARISGDDELQGNTKRIAGTYGYMSPEYAL*GLNSIKSKVFNFGVLMLE 501
            KRLS +S  G +EF+NE++++AKLQHR+LV+L G C+E  E IL+YE++PNKSLD FLF+P  +  L W  R +II GIA+G+LYLH+ SRL IIHRDLKA NILLD+DMNPK++ FGMARI G D+ + NT+R+ GTYGYM+PEYA+ G  S+KS V++FGVL+LE
Sbjct:  372 KRLSKNSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSLDYFLFDPTMQGQLDWSRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDADMNPKVADFGMARIFGMDQTEANTRRVVGTYGYMAPEYAMYGKFSMKSDVYSFGVLVLE 538          
BLAST of EY665192 vs. ExPASy Swiss-Prot
Match: CRK7_ARATH (Cysteine-rich receptor-like protein kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.241e-53
Identity = 107/169 (63.31%), Postives = 132/169 (78.11%), Query Frame = 1
Query:    1 KRLSSHSRLGLEEFKNEMMLIAKLQHRHLVRLFGCCVEQGENILIYEYMPNKSLDVFLFNPKKKRLLGWQARVRIIEGIAQGLLYLHRYSRLRIIHRDLKASNILLDSDMNPKISYFGMARISGDDELQGNTKRIAGTYGYMSPEYAL*GLNSIKSKVFNFGVLMLETL 507
            KRLS  S  G  EFKNE++++A L+H++LVR+ G  +E+ E IL+YEY+ NKSLD FLF+P KK  L W  R  II GIA+G+LYLH+ SRL IIHRDLKASNILLD+DMNPKI+ FGMARI G D+ Q NT RI GTYGYMSPEYA+ G  S+KS V++FGVL+LE +
Sbjct:  364 KRLSKTSEQGDTEFKNEVVVVANLRHKNLVRILGFSIEREERILVYEYVENKSLDNFLFDPAKKGQLYWTQRYHIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGMDQTQQNTSRIVGTYGYMSPEYAMRGQFSMKSDVYSFGVLVLEII 532          
The following BLAST results are available for this feature:
BLAST of EY665192 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 404
Match NameE-valueIdentityDescription
CRK25_ARATH3.373e-5966.86Cysteine-rich receptor-like protein kinase 25 OS=A... [more]
CRK10_ARATH9.186e-5765.09Cysteine-rich receptor-like protein kinase 10 OS=A... [more]
CRK35_ARATH1.200e-5665.68Putative cysteine-rich receptor-like protein kinas... [more]
CRK15_ARATH1.732e-5563.31Cysteine-rich receptor-like protein kinase 15 OS=A... [more]
CRK11_ARATH1.732e-5563.31Cysteine-rich receptor-like protein kinase 11 OS=A... [more]
CRK12_ARATH3.859e-5563.91Putative cysteine-rich receptor-like protein kinas... [more]
CRK8_ARATH8.597e-5563.91Cysteine-rich receptor-like protein kinase 8 OS=Ar... [more]
CRK6_ARATH1.467e-5463.91Cysteine-rich receptor-like protein kinase 6 OS=Ar... [more]
CRK20_ARATH1.467e-5461.68Putative cysteine-rich receptor-like protein kinas... [more]
CRK7_ARATH1.241e-5363.31Cysteine-rich receptor-like protein kinase 7 OS=Ar... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-B01-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665192 ID=EY665192|Name=EY665192|organism=Citrus sinensis|type=EST|length=911bp
AAAAGGCTCTCGAGTCACTCCCGTCTAGGACTCGAAGAGTTTAAAAATGA
GATGATGCTTATAGCAAAACTCCAACACAGACACCTTGTCAGACTCTTCG
GTTGCTGTGTAGAACAAGGCGAAAACATTTTAATCTATGAGTACATGCCT
AACAAAAGCTTGGATGTTTTCCTTTTCAATCCAAAGAAAAAGCGCCTGCT
AGGTTGGCAAGCACGTGTTAGAATTATTGAAGGAATTGCCCAAGGACTAT
TATATCTTCATCGGTATTCTAGACTGAGAATTATTCACAGAGATCTTAAG
GCAAGTAATATTCTCTTAGATAGTGACATGAACCCCAAAATATCATATTT
TGGCATGGCAAGAATATCTGGTGATGATGAGTTGCAGGGAAATACTAAAC
GGATTGCTGGAACTTATGGTTACATGTCACCTGAGTATGCCCTATAAGGC
CTGAACTCCATTAAATCAAAAGTGTTTAACTTTGGAGTATTAATGTTGGA
AACATTGAGAAGAAAGAAAAAAACTGGGCGTCACCATAAGTGATCCCTTT
ACCTTCTTGGATTGCTTGGGAGCCAAGGAAAGAAGACAAAACACATGAAT
TGATGGGACCCAGATATAAGCAAAAAGACAAATCATTGCCAAGGCGGATT
AAAACATAAATTGGGGTACTCCCCGTGTTCAGAAAATGGCCTGTAAAACC
ATACTGGTCCGAAGGTACCCACAAAGATGAGAGAGGCATCTTATTTTCCC
TTCCCCCAAAACCACGTTGTAAAAAGATAGAAAGGAAAAATAAACGCACA
CAAGGGTTCCCGGAGAGAAAGACGCTTTAAATTAAAGCAACCACAATATA
ATATAGGAGGGCTCCATTTGTTAAACTCTTTGATTAATTCCCATGTTAAA
GCATATACATA
back to top