EY665188

Overview
NameEY665188
Unique NameEY665188
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1012
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig519 contig Csv1_Contig519:51..1063. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY665188 vs. ExPASy Swiss-Prot
Match: M3K1_ARATH (Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2)

HSP 1 Score: 60.4622 bits (145), Expect = 9.496e-15
Identity = 30/61 (49.18%), Postives = 44/61 (72.13%), Query Frame = 2
Query:  173 SQWQKGELIGRGTFGSVYIGTNRETGASCAIKEVDIILDDPKSAECIKKLEQEIKLLHHLK 355
            + WQKG+L+GRG+FGSVY G + + G   A+KEV ++    ++ ECI++LE EIKLL  L+
Sbjct:  331 TSWQKGQLLGRGSFGSVYEGISGD-GDFFAVKEVSLLDQGSQAQECIQQLEGEIKLLSQLQ 390          

HSP 2 Score: 40.0466 bits (92), Expect = 9.496e-15
Identity = 36/112 (32.14%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  354 RHENIMQYYGS-----------EVIRPVNIGEILQK-----SIVCNFTRQILNGVGYLHKHHHNSKGILKGKNC*FEASGVVKLSKILGIGKTSLQGTLPRIWQLKGTPIFW 641
            +H+NI++Y G+           E++   ++ ++ Q+     S+V  +TRQIL+G+ YLH      + I K  N   +A+G VKL+   G+ K S       I   KGTP FW
Sbjct:  390 QHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLYTRQILDGLKYLHDKGFIHRDI-KCANILVDANGAVKLAD-FGLAKVS---KFNDIKSCKGTP-FW 495          
BLAST of EY665188 vs. ExPASy Swiss-Prot
Match: ANP1_ARATH (Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 2.700e-14
Identity = 28/61 (45.90%), Postives = 42/61 (68.85%), Query Frame = 2
Query:  179 WQKGELIGRGTFGSVYIGTNRETGASCAIKEVDI---ILDDPKSAECIKKLEQEIKLLHHL 352
            W+KG+LIGRG FG+VY+G N ++G   A+K+V I        K+   I++LE+E+KLL +L
Sbjct:   69 WRKGQLIGRGAFGTVYMGMNLDSGELLAVKQVLIAANFASKEKTQAHIQELEEEVKLLKNL 129          

HSP 2 Score: 43.1282 bits (100), Expect = 2.700e-14
Identity = 33/112 (29.46%), Postives = 53/112 (47.32%), Query Frame = 3
Query:  357 HENIMQYYGS-----------EVIRPVNIGEILQK------SIVCNFTRQILNGVGYLHKHHHNSKGILKGKNC*FEASGVVKLSKILGIGKTSLQGTLPRIWQLKGTPIFW 641
            H NI++Y G+           E +   +I  +L+K      S+V  +TRQ+L G+ YLH H    + I KG N   +  G +KL+      + +   T+     +KGTP +W
Sbjct:  131 HPNIVRYLGTVREDDTLNILLEFVPGGSISSLLEKFGPFPESVVRTYTRQLLLGLEYLHNHAIMHRDI-KGANILVDNKGCIKLADFGASKQVAELATMTGAKSMKGTP-YW 240          
BLAST of EY665188 vs. ExPASy Swiss-Prot
Match: M3K2_ARATH (Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 9.993e-14
Identity = 28/62 (45.16%), Postives = 43/62 (69.35%), Query Frame = 2
Query:  176 QWQKGELIGRGTFGSVYIGTNRETGASCAIKEVDI---ILDDPKSAECIKKLEQEIKLLHHL 352
            +W+KG+LIGRG FG+VY+G N ++G   A+K+V I        K+   I++LE+E+KLL +L
Sbjct:   67 RWRKGQLIGRGAFGTVYMGMNLDSGELLAVKQVLITSNCASKEKTQAHIQELEEEVKLLKNL 128          

HSP 2 Score: 41.2022 bits (95), Expect = 9.993e-14
Identity = 32/112 (28.57%), Postives = 52/112 (46.43%), Query Frame = 3
Query:  357 HENIMQYYGS-----------EVIRPVNIGEILQK------SIVCNFTRQILNGVGYLHKHHHNSKGILKGKNC*FEASGVVKLSKILGIGKTSLQGTLPRIWQLKGTPIFW 641
            H NI++Y G+           E +   +I  +L+K      S+V  +T Q+L G+ YLH H    + I KG N   +  G +KL+      + +   T+     +KGTP +W
Sbjct:  130 HPNIVRYLGTVREDETLNILLEFVPGGSISSLLEKFGAFPESVVRTYTNQLLLGLEYLHNHAIMHRDI-KGANILVDNQGCIKLADFGASKQVAELATISGAKSMKGTP-YW 239          
BLAST of EY665188 vs. ExPASy Swiss-Prot
Match: STE11_YEAST (Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae GN=STE11 PE=1 SV=3)

HSP 1 Score: 46.2098 bits (108), Expect = 3.868e-12
Identity = 33/92 (35.87%), Postives = 48/92 (52.17%), Query Frame = 3
Query:  357 HENIMQYYGS-----------EVIRPVNIGEIL------QKSIVCNFTRQILNGVGYLHKHHHNSKGILKGKNC*FEASGVVKLSKILGIGK 581
            HENI+ YYG+           E +   ++  +L      ++S++ NFTRQIL GV YLHK +   + I KG N   +  G VK++   GI K
Sbjct:  513 HENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDI-KGANILIDIKGCVKITD-FGISK 602          

HSP 2 Score: 45.4394 bits (106), Expect = 3.868e-12
Identity = 27/73 (36.99%), Postives = 36/73 (49.32%), Query Frame = 2
Query:  134 SHITEKTSASSKKSQWQKGELIGRGTFGSVYIGTNRETGASCAIKEVDI-------ILDDPKSAECIKKLEQE 331
            S I    +  +    W KG  IG G+FGSVY+G N  TG   A+K+V+I         D+ K A   +  EQE
Sbjct:  400 SDIVSLPTKIATPKNWLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQE 472          
BLAST of EY665188 vs. ExPASy Swiss-Prot
Match: STE11_YEAS7 (Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain YJM789) GN=STE11 PE=3 SV=1)

HSP 1 Score: 46.2098 bits (108), Expect = 3.868e-12
Identity = 33/92 (35.87%), Postives = 48/92 (52.17%), Query Frame = 3
Query:  357 HENIMQYYGS-----------EVIRPVNIGEIL------QKSIVCNFTRQILNGVGYLHKHHHNSKGILKGKNC*FEASGVVKLSKILGIGK 581
            HENI+ YYG+           E +   ++  +L      ++S++ NFTRQIL GV YLHK +   + I KG N   +  G VK++   GI K
Sbjct:  513 HENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDI-KGANILIDIKGCVKITD-FGISK 602          

HSP 2 Score: 45.4394 bits (106), Expect = 3.868e-12
Identity = 27/73 (36.99%), Postives = 36/73 (49.32%), Query Frame = 2
Query:  134 SHITEKTSASSKKSQWQKGELIGRGTFGSVYIGTNRETGASCAIKEVDI-------ILDDPKSAECIKKLEQE 331
            S I    +  +    W KG  IG G+FGSVY+G N  TG   A+K+V+I         D+ K A   +  EQE
Sbjct:  400 SDIVSLPTKIATPKNWLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQE 472          
BLAST of EY665188 vs. ExPASy Swiss-Prot
Match: STE11_YEAS6 (Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=STE11 PE=3 SV=2)

HSP 1 Score: 45.8246 bits (107), Expect = 5.022e-12
Identity = 27/73 (36.99%), Postives = 36/73 (49.32%), Query Frame = 2
Query:  134 SHITEKTSASSKKSQWQKGELIGRGTFGSVYIGTNRETGASCAIKEVDI-------ILDDPKSAECIKKLEQE 331
            S I    +  +    W KG  IG G+FGSVY+G N  TG   A+K+V+I         D+ K A   +  EQE
Sbjct:  400 SDIVSLPTKIATPKNWLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVSTDNNKQANSDENNEQE 472          

HSP 2 Score: 45.4394 bits (106), Expect = 5.022e-12
Identity = 33/92 (35.87%), Postives = 47/92 (51.09%), Query Frame = 3
Query:  357 HENIMQYYGS-----------EVIRPVNIGEIL------QKSIVCNFTRQILNGVGYLHKHHHNSKGILKGKNC*FEASGVVKLSKILGIGK 581
            HENI+ YYG+           E +   ++  +L      ++S++ NFTRQIL GV YLHK     + I KG N   +  G VK++   GI K
Sbjct:  513 HENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKKIIHRDI-KGANILIDIKGCVKITD-FGISK 602          
BLAST of EY665188 vs. ExPASy Swiss-Prot
Match: M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 3.131e-11
Identity = 25/68 (36.76%), Postives = 43/68 (63.24%), Query Frame = 2
Query:  152 TSASSKKSQWQKGELIGRGTFGSVYIGTNRETGASCAIKEVDIILDDPKSAECIKKLEQEIKLLHHLK 355
            T + S    W++G+L+G+G FG VY+  + +TG   A K+V    D P++++ +  LE EI+LL +L+
Sbjct:  353 TKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ 420          

HSP 2 Score: 36.1946 bits (82), Expect = 3.131e-11
Identity = 29/87 (33.33%), Postives = 40/87 (45.98%), Query Frame = 3
Query:  354 RHENIMQYYGSEVIRPVNIGEI-------------------LQKSIVCNFTRQILNGVGYLHKHHHNSKGILKGKNC*FEASGVVKL 557
            +HE I+QYYG    R   I  I                   L +S+   +TRQIL G+ YLH +    + I KG N   +++G VKL
Sbjct:  420 QHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDI-KGANILRDSAGNVKL 505          
BLAST of EY665188 vs. ExPASy Swiss-Prot
Match: M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 52.373 bits (124), Expect = 5.275e-11
Identity = 25/68 (36.76%), Postives = 43/68 (63.24%), Query Frame = 2
Query:  152 TSASSKKSQWQKGELIGRGTFGSVYIGTNRETGASCAIKEVDIILDDPKSAECIKKLEQEIKLLHHLK 355
            T + S    W++G+L+G+G FG VY+  + +TG   A K+V    D P++++ +  LE EI+LL +L+
Sbjct:  353 TKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ 420          

HSP 2 Score: 35.4242 bits (80), Expect = 5.275e-11
Identity = 35/112 (31.25%), Postives = 48/112 (42.86%), Query Frame = 3
Query:  354 RHENIMQYYG-------------------SEVIRPVNIGEILQKSIVCNFTRQILNGVGYLHKHHHNSKGILKGKNC*FEASGVVKL-----SKIL------GIGKTSLQGT 599
            +HE I+QYYG                     V   +     L +S+   +TRQIL G+ YLH +    + I KG N   +++G VKL     SK L      G G  S+ GT
Sbjct:  420 QHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDI-KGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGT 530          
BLAST of EY665188 vs. ExPASy Swiss-Prot
Match: M3K3_ARATH (Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 6.839e-11
Identity = 28/62 (45.16%), Postives = 41/62 (66.13%), Query Frame = 2
Query:  176 QWQKGELIGRGTFGSVYIGTNRETGASCAIKEVDII---LDDPKSAECIKKLEQEIKLLHHL 352
            +W+KGELIG G FG VY+G N ++G   AIK+V I        K+   I++LE+E++LL +L
Sbjct:   67 RWRKGELIGCGAFGRVYMGMNLDSGELLAIKQVLIAPSSASKEKTQGHIRELEEEVQLLKNL 128          

HSP 2 Score: 35.4242 bits (80), Expect = 6.839e-11
Identity = 29/112 (25.89%), Postives = 51/112 (45.54%), Query Frame = 3
Query:  357 HENIMQYYGS-----------EVIRPVNIGEILQK------SIVCNFTRQILNGVGYLHKHHHNSKGILKGKNC*FEASGVVKLSKILGIGKTSLQGTLPRIWQLKGTPIFW 641
            H NI++Y G+           E +   +I  +L+K       ++  +T+Q+L G+ YLH +    + I KG N   +  G ++L+      K     T+     +KGTP +W
Sbjct:  130 HPNIVRYLGTVRESDSLNILMEFVPGGSISSLLEKFGSFPEPVIIMYTKQLLLGLEYLHNNGIMHRDI-KGANILVDNKGCIRLADFGASKKVVELATVNGAKSMKGTP-YW 239          
The following BLAST results are available for this feature:
BLAST of EY665188 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
M3K1_ARATH9.496e-1549.18Mitogen-activated protein kinase kinase kinase 1 O... [more]
ANP1_ARATH2.700e-1445.90Mitogen-activated protein kinase kinase kinase ANP... [more]
M3K2_ARATH9.993e-1445.16Mitogen-activated protein kinase kinase kinase 2 O... [more]
STE11_YEAST3.868e-1235.87Serine/threonine-protein kinase STE11 OS=Saccharom... [more]
STE11_YEAS73.868e-1235.87Serine/threonine-protein kinase STE11 OS=Saccharom... [more]
STE11_YEAS65.022e-1236.99Serine/threonine-protein kinase STE11 OS=Saccharom... [more]
M3K3_MOUSE3.131e-1136.76Mitogen-activated protein kinase kinase kinase 3 O... [more]
M3K3_HUMAN5.275e-1136.76Mitogen-activated protein kinase kinase kinase 3 O... [more]
M3K3_ARATH6.839e-1145.16Mitogen-activated protein kinase kinase kinase 3 O... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-A08-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665188 ID=EY665188|Name=EY665188|organism=Citrus sinensis|type=EST|length=1012bp
CCCGCGTCCGAATCTCTTCCCAGAATTCGCACCGAGTTGCTTGAAAGTAA
TCATCATCTCAATGCCCCATCCATTGCCCCTTCCACCTGGAGCTTTATCA
CCACCTAAATCATCTGCAACATCAGCCGTTATGTCTCACATAACGGAAAA
GACAAGTGCATCCTCTAAGAAAAGTCAATGGCAGAAAGGTGAACTTATTG
GACGTGGTACATTTGGGAGTGTTTATATTGGAACAAACCGGGAGACTGGA
GCTTCATGTGCAATAAAGGAAGTTGATATTATTCTTGATGACCCCAAATC
TGCCGAATGCATAAAGAAATTGGAGCAGGAAATTAAACTTCTCCATCATT
TGAAGGCATGAAAATATAATGCAGTATTATGGAAGTGAAGTGATACGTCC
CGTGAACATTGGGGAAATATTACAAAAAAGTATAGTTTGCAATTTCACCC
GTCAAATTCTCAATGGGGTTGGCTACCTGCATAAGCACCACCACAATTCA
AAGGGAATATTAAAGGGAAAAAATTGCTAATTTGAAGCATCTGGGGTTGT
TAAGCTTAGCAAAATTTTGGGGATAGGAAAAACATCCTTACAGGGAACCC
TCCCTAGAATATGGCAATTGAAGGGGACACCCATATTTTGGGAGGGGTCT
CAAAAGGCTTGGCCGGGGTTAAATACCCAAAGGGGAGGGAAAAACACTAA
GGGTTAGCTTTACTTGTCTGTAATTTAGAGACTTTTAAGGTTGTAACTGG
CTCATGGAAATATGGAATAGTGGGAAACACCCACATTGGAAAAAGAGGTT
TGTGGAAGGGGCCCTCAAACATATATTGTCGAAGGGATGATTGAGAATAA
GACCCACCCCCCCCTATTTTCAAATGAAAAAAAGTTGATTTTTCTTACAC
AGAAGGAGGAAAGAAAGATTTGATTTTATTGACACATGTTGACGAACAAA
GCATAGAAAATAAAAAAGCCGTTGGCGAAAAAAAGCAGACCCACAAACAA
TTGATCTGGGTG
back to top