EY665183

Overview
NameEY665183
Unique NameEY665183
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length631
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665183 vs. ExPASy Swiss-Prot
Match: VTI12_ARATH (Vesicle transport v-SNARE 12 OS=Arabidopsis thaliana GN=VTI12 PE=1 SV=3)

HSP 1 Score: 132.88 bits (333), Expect = 1.329e-30
Identity = 68/100 (68.00%), Postives = 80/100 (80.00%), Query Frame = 3
Query:    6 RPAMSVERIHQSGERIRESRRVMLETEELGISIVEDLNQQRETLLNSRNKLHGVDDAISKSKKVLSSMSRRMTRNKWIVGSXXXXXXXXXXXXXXYKLSH 305
            R AMSVER+ QS +RIRESRR+MLETEE+GISIV+DL+QQR+TLL++ NKLHGVDDAI KSKKVL++MSRRMTRNKWI+ S              YKLSH
Sbjct:  123 RLAMSVERLDQSSDRIRESRRLMLETEEVGISIVQDLSQQRQTLLHAHNKLHGVDDAIDKSKKVLTAMSRRMTRNKWIITSVIVALVLAIILIISYKLSH 222          
BLAST of EY665183 vs. ExPASy Swiss-Prot
Match: VTI11_ARATH (Vesicle transport v-SNARE 11 OS=Arabidopsis thaliana GN=VTI11 PE=1 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 2.777e-20
Identity = 43/81 (53.09%), Postives = 65/81 (80.25%), Query Frame = 3
Query:    6 RPAMSVERIHQSGERIRESRRVMLETEELGISIVEDLNQQRETLLNSRNKLHGVDDAISKSKKVLSSMSRRMTRNKWIVGS 248
            R  MS ER+ ++ +R+++SRR M+ETEE+G+SI++DL+ QR++LL +   LHGVDD I KSKK+L+ M+RRM +NKW +G+
Sbjct:  122 RLMMSTERLGRTTDRVKDSRRTMMETEEIGVSILQDLHGQRQSLLRAHETLHGVDDNIGKSKKILTDMTRRMNKNKWTIGA 202          
BLAST of EY665183 vs. ExPASy Swiss-Prot
Match: VTI13_ARATH (Vesicle transport v-SNARE 13 OS=Arabidopsis thaliana GN=VTI13 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 6.187e-20
Identity = 43/82 (52.44%), Postives = 66/82 (80.49%), Query Frame = 3
Query:    3 TRPAMSVERIHQSGERIRESRRVMLETEELGISIVEDLNQQRETLLNSRNKLHGVDDAISKSKKVLSSMSRRMTRNKWIVGS 248
            +R  MS + + ++ +RI++SRR +LETEELG+SI++DL+ QR++LL +   LHGVDD + KSKK+L++M+RRM RNKW +G+
Sbjct:  121 SRLMMSTDHLGRTTDRIKDSRRTILETEELGVSILQDLHGQRQSLLRAHETLHGVDDNVGKSKKILTTMTRRMNRNKWTIGA 202          
The following BLAST results are available for this feature:
BLAST of EY665183 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
VTI12_ARATH1.329e-3068.00Vesicle transport v-SNARE 12 OS=Arabidopsis thalia... [more]
VTI11_ARATH2.777e-2053.09Vesicle transport v-SNARE 11 OS=Arabidopsis thalia... [more]
VTI13_ARATH6.187e-2052.44Vesicle transport v-SNARE 13 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-A03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665183 ID=EY665183|Name=EY665183|organism=Citrus sinensis|type=EST|length=631bp
CCACGCGTCCGGCCATGTCAGTTGAGAGAATCCATCAGTCAGGTGAAAGA
ATTAGGGAGAGTAGAAGAGTCATGCTAGAGACAGAGGAGCTTGGTATCTC
AATTGTGGAAGATCTGAATCAACAGCGTGAAACTCTGTTAAATTCTCGTA
ACAAGCTTCATGGGGTGGATGATGCCATAAGCAAGAGTAAAAAGGTTTTA
TCTTCCATGTCACGGAGAATGACCAGGAACAAATGGATCGTTGGCTCAAT
AATTGTAGCTCTTGTCATTGCCATAATCTTTATCCTCTTTTATAAGCTTT
CACATCACTAGTCTGACCATTTCAAATGCTCAAGTTCAAGGAAAGTTCTG
TTGCATGTTGTACAAAGTTACCGGGGATTTAATGGATATATATTCCCAAT
TTTCTTCATGTTATCTACTTGATCAATAATTGGTTGTATCTTTATGTCCA
TTTCTGATGTATTTGCCTTTATCGATTATCATTGGTCAATTTCTTTGCTT
GAAATTTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGGGGGGCCGCT
CCTAAAGGAATCCAAGCTTTATTTACCCGTGGCATGGCAACGCCTAACTT
CTTTCTAAAGTGGTCACCAAAATTTCATTTC
back to top