EY665174
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY665174 vs. ExPASy Swiss-Prot
Match: ATB15_ARATH (Homeobox-leucine zipper protein ATHB-15 OS=Arabidopsis thaliana GN=ATHB-15 PE=1 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.452e-14 Identity = 34/36 (94.44%), Postives = 35/36 (97.22%), Query Frame = 3 Query: 3 SMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV 110 SMGRPVSYERAVAWKVLNEEE AHCICF+FINWSFV Sbjct: 801 SMGRPVSYERAVAWKVLNEEENAHCICFVFINWSFV 836
BLAST of EY665174 vs. ExPASy Swiss-Prot
Match: HOX32_ORYSJ (Homeobox-leucine zipper protein HOX32 OS=Oryza sativa subsp. japonica GN=HOX32 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.503e-11 Identity = 27/36 (75.00%), Postives = 34/36 (94.44%), Query Frame = 3 Query: 3 SMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV 110 SMGRPVSYE+AVAWKVL++++T HC+ FMF+NWSFV Sbjct: 824 SMGRPVSYEQAVAWKVLSDDDTPHCLAFMFVNWSFV 859
BLAST of EY665174 vs. ExPASy Swiss-Prot
Match: HOX32_ORYSI (Homeobox-leucine zipper protein HOX32 OS=Oryza sativa subsp. indica GN=HOX32 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.503e-11 Identity = 27/36 (75.00%), Postives = 34/36 (94.44%), Query Frame = 3 Query: 3 SMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV 110 SMGRPVSYE+AVAWKVL++++T HC+ FMF+NWSFV Sbjct: 824 SMGRPVSYEQAVAWKVLSDDDTPHCLAFMFVNWSFV 859
BLAST of EY665174 vs. ExPASy Swiss-Prot
Match: ATHB8_ARATH (Homeobox-leucine zipper protein ATHB-8 OS=Arabidopsis thaliana GN=ATHB-8 PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.348e-11 Identity = 26/36 (72.22%), Postives = 32/36 (88.89%), Query Frame = 3 Query: 3 SMGRPVSYERAVAWKVLNEEETAHCICFMFINWSFV 110 SMGR V+YE+AV WKVLN++E HCICFMF+NWSF+ Sbjct: 798 SMGRAVTYEKAVGWKVLNDDEDPHCICFMFLNWSFI 833 The following BLAST results are available for this feature:
BLAST of EY665174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY665174 ID=EY665174; Name=EY665174; organism=Citrus sinensis; type=EST; length=338bpback to top |